KEGG   Anopheles gambiae (mosquito): AgaP_AGAP006945Help
Entry
AgaP_AGAP006945   CDS       T01036                                 

Definition
AGAP006945-PA
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:aga00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    AgaP_AGAP006945
Enzymes [BR:aga01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     AgaP_AGAP006945
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2L
AA seq 871 aa AA seqDB search
MKRPGEPVQRLQPAKKNVNVVSNTNSAHDSQLPAAAVPVSHDDRLSGSSSCSKTIFKVVW
GKISTRKHKTWEGDGTLEVSGRSAVLKDEAGKVITTASGLKIDEVTEGIQLVVGSKEVEV
LEKCNENQQPRLENSSTVVSSTGGSKICLPVPSIGGFKPPVQVVRDDVEAEARSEASPRI
DAVPLVDTTNFSRDSSCRVQNNFKSVFTTREDEQEAVQPLIMKKPSFEHQFQHNAQNEPV
VEVQVPLCVTRHLRPHQREGVAFLYECVTGLRMLEPPGCGAILADEMGLGKTLQCIALMY
TLLKTGPYGKPLAKRVLIVTPSSLVDNWDREITKWLRSERIFTFIVGPNNKLKRYAQSPH
IPILIISYEMLAKQIGELETVKFDLMFCDEGHRLKNSNVKAFGVLNRLECRRRVLLTGTP
IQNDLQEFFSLINFVNPGAIGTYQDFKARYETPIVVSQRPGVLPQSIELGIERLNELNAI
TGRFVLRRTQEVINRYLPDKHEVVVFCHPSALQTQLTRTALSFYDSEKGADNAVSPLQLI
TILKKICNHPSLVSVQGKGDPESLVHLLAEQLPPWQRMGPTDSAKLGIVEALLEAMLAMQ
EKIVIVSYYSKTLDMIGGLCDHYNYKYCRLDGSTAGPDRSRIVAAFNNPANDSFILLLSA
KAGGAGLNLIGASRLVLYDNDWNPANDLQAMSRVWRDGQRKPVFIYRLLTAYSIEERIFQ
RQISKTSLSGTVVDQRQNLSNLKLSEEELKDLFSIIDPNAEADCLTHSLLECPCAGIGNA
PDRVAELPELCDPLDDLTNEPISRFQLRPTVGGGGKHGKLGTKKHALKMQELMRWEHHRS
PVSERVLEQLGLARSADEIVFLFRNIVSAPK
NT seq 2616 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgtcccggcgaaccggtacaaaggttacagccggcaaagaaaaatgttaatgta
gtgagcaataccaacagtgcgcacgattcgcaactcccagccgcagccgtcccagtaagc
catgacgataggctctcgggttcttccagctgttccaaaaccatctttaaggtagtgtgg
ggaaaaattagcacaaggaaacacaagacctgggaaggcgacggtacgctcgaagtgtcc
ggcagaagtgcggtgttgaaggatgaagcgggcaaagtaatcaccacggccagcggatta
aagattgacgaagtgacggaaggtatccagctggtggtgggttcgaaggaggtggaagtt
ttggagaaatgcaatgaaaatcaacaaccaaggttggaaaactcgtcaaccgtagtaagc
agtactggtggttcgaagatttgtttgccagtaccctcgattggtggttttaaaccgcca
gtgcaagtggtgcgggatgatgttgaagcggaagcacgatcagaagcatctcccaggatt
gatgctgtgccgctggttgatacgacaaacttttcccgcgatagttcctgtagagtgcag
aacaattttaaatcggtctttacaacccgagaagacgaacaagaggcagtgcaaccactg
attatgaagaaaccatcgttcgaacatcaatttcaacacaatgctcaaaatgaaccggtg
gtggaggtgcaggtcccgctctgtgttacacgccacctgcgaccacaccagcgcgaaggg
gttgccttcctgtacgaatgtgtgaccgggctgagaatgctggaaccgcccgggtgcggt
gcaatattggccgacgagatggggctcggtaagacgctgcagtgcattgcgctcatgtat
acgctgctaaagaccggtccgtacggaaaaccgctcgccaagcgtgttctgatcgtcacc
cccagcagtttggtggataactgggaccgagaaattaccaagtggctgcgaagcgagcga
atctttacgttcatcgttgggccgaacaataaactcaaacggtacgcccagtcgccgcac
attcccatactgatcatatcgtacgagatgttggcaaagcagatcggcgaactggagacg
gtcaagttcgatctgatgttttgcgacgaagggcaccggttgaagaacagcaacgtgaag
gcgttcggcgtgctgaatcggctggagtgccggcgccgggtgctgctaaccggtacaccc
atacagaacgatctgcaggaatttttctccctaattaactttgtcaatccgggagcgatc
ggtacgtaccaggatttcaaggcacgttacgaaacgccgatcgttgtatcgcaacgaccc
ggcgtactgccacaatcgatcgagctcgggatcgagcggctaaacgagctgaacgcgata
acgggccgttttgtgctgaggcgcactcaggaagtgatcaaccgatatctgcccgacaag
cacgaagtggtcgtgttttgccatccgtccgcgctgcagacgcaactgacccgaacagca
ctgtcgttttacgacagtgaaaaaggtgcggacaatgcggtttctccgctacagttgatt
acgattctgaaaaagatctgtaatcacccgtcgctcgtgtcggtacaggggaagggggat
ccggaatcgttggtgcatttgctggcggaacagttgccaccctggcagcggatgggaccg
accgattcggccaagctgggcattgtggaggcactgctggaagcaatgctggcaatgcag
gaaaagatcgtgatcgtgtcgtactatagcaaaacgctcgatatgatcggtgggttgtgt
gaccattacaactacaagtactgtcggttggacggatcgacggcgggtcccgatcggtcc
cggatcgtggccgcattcaacaaccctgccaacgatagtttcatactgctgcttagcgcc
aaagcgggcggtgcagggctgaatctgatcggtgcctctcggctggtgctgtacgataat
gactggaacccggccaacgacctgcaagccatgtcacgcgtgtggcgtgatggccaacgg
aaaccggtgttcatttaccgactcctgaccgcttactccatcgaggagcggatatttcag
cgacaaatttcgaaaacctccctcagcggtacggtggtagaccagcggcaaaacttgagc
aatctcaaactatccgaagaagagctgaaggatctgttctccatcatcgatcccaatgct
gaggccgactgtttgacgcacagtttgctggagtgtccgtgtgcgggtatcggtaatgca
ccggatagagtggcagagctgccggaattgtgcgacccgctggatgatcttaccaacgaa
ccgataagtcgcttccagctaagacccactgttggtggtggaggcaagcatggcaagcta
ggtacgaaaaagcacgccctcaagatgcaggaactaatgcgctgggaacatcaccgatcg
cccgtgtccgaacgggtcctggaacagctcgggctggctcggagtgccgacgagatagtg
tttttgtttcgaaacattgtatcagcaccgaaataa

DBGET integrated database retrieval system