KEGG   Anopheles gambiae (mosquito): AgaP_AGAP006995Help
Entry
AgaP_AGAP006995   CDS       T01036                                 

Definition
AGAP006995-PA
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:aga00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    AgaP_AGAP006995
Enzymes [BR:aga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     AgaP_AGAP006995
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2L
AA seq 627 aa AA seqDB search
MILAAAGSAATVYLTETFYISSKKNTVFEVRLTDKGLCLKKQSNGATKEQTIPLKDIIGC
RCLRSKRRSRGSSSCTCASISSSSQLKVVEENSGEQDETDVSAYLYIYAYILKRSRRGGF
RERTTITLRFRSFDRYEDNNREAQKWRASIKQLVAGEPVQKPVAYQPRDTRKMLIILNPK
SGSGKAREMFQQRVAPIFAEAEIPYDLHITKKSNWAREFVRVRDVYLWRGIVVVGGDGIF
FEVLNGLFEREDWQTAIDELPMGIIPCGSGNGLAKTVSFLYEEPFETKPVLASALMVVKG
KHSMLDVVRVETRSNIMFSFLSVGWGLISDIDIESERLRAIGGQRFTVWSVHRLISLRTY
QGKVSYLPALVSPVSGAGGEGLNGGGGGIGTLKHSVSYNTTLNCRDCRAGLGGQDGTNGS
CDACDTNFSDVLSLETGTNLDSFRPRIDSWYSATSRKSTYFSTVDSVYESDKASNDDPTQ
CGPNGGTASHVQMYGPPSRLPALTAAIPDSWQTIAGEFVMVHAAYQTHLSTECYFAPQSR
LNDGIIWLLIIRAGVSRSQLLSFLLGLSSGTHLPLQPNEYIQMVPVSAFRIEPAGTNGHM
TVDGEKVECGPIQGEVFPSLGKVMVPK
NT seq 1884 nt NT seq  +upstreamnt  +downstreamnt
atgatcctggcggcggcagggtccgccgccaccgtctacctaaccgaaacgttctacatc
agctcgaagaagaacaccgtgttcgaggtgcggctcaccgacaagggcctctgcctgaag
aagcaatcgaacggcgcgacgaaggagcagacgatcccgctcaaagacatcatcggctgc
cggtgtttgcgcagcaagcgccggtcgcgcggcagctcctcctgtacctgcgcgtccatc
tcgagctcgagccagctgaaggtggtggaggaaaactcgggcgagcaggacgaaacggac
gtgagcgcgtatctgtacatctacgcctacatcctgaagcgcagccggcggggcgggttc
cgcgagcgcaccaccatcacgctgcgcttccgctcgttcgaccggtacgaggacaacaac
cgggaggcgcagaagtggcgcgcctcgatcaagcagctggtggcgggcgagccggtccag
aagccggtggcgtaccagccgcgcgacacgcgcaaaatgctcatcatactgaaccccaag
tccggctcgggaaaggcgcgggagatgtttcagcagcgcgtggcgcccatctttgccgag
gcggagattccgtacgatctgcacatcacgaagaagagcaactgggcgcgggagtttgtg
cgcgtgcgggatgtgtacctgtggcgcgggatcgtcgtcgtcggcggggacggtatcttc
ttcgaggtgctgaacgggctgttcgagcgcgaggattggcagacggcgatcgacgagctg
ccgatggggatcatcccgtgcgggtccggcaatgggttggcgaaaaccgtgtcctttctt
tatgaagagcctttcgaaacgaaacccgtactggcgtcagctttaatggtagttaaggga
aaacattccatgttagacgtagttagagtcgaaactcgttccaatatcatgttctcgttc
ctgtcggtcggctggggtctcatctcggacattgatatcgaaagcgagcggttgcgtgcc
atcggcgggcagcggttcaccgtctggtccgtccaccggctgatcagcctgcgcacgtac
cagggcaaggtgtcctacctgcccgccctcgtcagccccgtcagcggggccggcggcgaa
gggctgaacgggggaggcggtggcatcggtacgctgaagcacagcgtcagctacaacacc
acgctcaactgtcgcgactgccgggcggggctgggcggacaggatggtacgaacggcagc
tgcgacgcctgtgatacaaactttagcgacgtgctgtcgctcgaaaccggcaccaatctg
gactcgttccggccgcgcatcgacagctggtactcggcgacgtcgcgcaaaagcacctac
ttctccacggtggacagtgtgtacgagagcgacaaggcttcgaacgacgatccgacgcag
tgcggccccaacggtggcacggcatcgcacgtgcagatgtacggaccaccgtcccggctg
ccggccctgacggcggccatcccggacagctggcagacgattgccggggagtttgtgatg
gtacacgccgcctaccagacgcacctcagcacggagtgttactttgcgccccagtcgcgg
ctgaacgatggtatcatttggttgctaatcatacgggcgggcgtttcccggtcgcagttg
ctttcgtttctgctggggttgagcagtggcacgcatctgccgctgcagccgaacgaatac
atccagatggtgccggtgtcggcgttccggattgagccggccggcacgaacggtcacatg
acggtggatggggagaaggtggagtgtggcccgatccagggggaggtgttccccagtctg
gggaaggtgatggtaccgaagtag

DBGET integrated database retrieval system