KEGG   Anopheles gambiae (mosquito): AgaP_AGAP007006Help
Entry
AgaP_AGAP007006   CDS       T01036                                 

Definition
AGAP007006-PA
Orthology
K04437  
filamin
Organism
aga  Anopheles gambiae (mosquito)
Brite
Exosome [BR:aga04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AgaP_AGAP007006
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2L
AA seq 1748 aa AA seqDB search
MSSPGLTALGESTRLVPANLPAVFEVLPPPGASIRGSDCVATVLSPSKTKVSARVTHESA
NGSLRIEFVPSEVGTHIIEASIGGTTLVGGPLIAKVYDSSLIQVTDVNGGVVGQPCQFRV
DASAAGEGQLEISINEGEVPNHVQVVGGGRCLVSFTPEQAKPHLIDIKFNGETVIGCPFV
CSVADTSRVLLNLTNLELIPVNRPASFHITVSGGGAAELAVSVRGPQGELPVRVTGDIHA
GFTAEFTPNHVGAHTINVEYNGYPVQGTPFVAKSYDATKVAVGSVSKGTVGRPVQFTVDA
GDAGEGNLEITISAKGHNIPTQVHPQGNAKFAVSFVPAEPCEHIINVSFNKMLVPGCPIT
VIINGGTTGPQVSLGGPGPLHMPNSLVINHAGGRLEDIEVNVEGPSGHSVPAQVLQTADG
VFKAEFVPRVVGEHRVSVTVEGQPTVGSPYSAKVYDVTAIKVKNVNNGTVGKPVVFLVET
SQAGPGNLEVTVNGGRVPTSAQAQGQHTYAISFTPREAQNHTVELRFNGQDVPGSPFTCK
VSPAARIVSSDLTDKVSVGHTFDFVVESDIAPVVEVLGPARRPVRADIVPAASPSSGYRV
KFEPVEVGDHSVEVRLPGSGHVEGSPFLLKAYSAEKVVVTDIRPGVVGKSVSFGINASQA
GAGNLEIIVAVGGKNVPNFVQSEGNARFKVNFKPTEAATHSLSVRFNGYPVPGSPFACHV
THAPVSLSKAIATGECLRQAPVKAESVFELEGFDGIDPQVLITAPSGDTVTSRVSFRDEV
HLVAFVPTSVGRHLISVTANDQHINGSPFSCNVFDVSRVSISGLDPRSTMASLGVPLTFS
VDAAGAGEGTLELVVSTATSTVKAEVTACARGLYDVTFIPQSCEPHFVNITFNDLPVEGS
PFRCEVQQNTQHVQVGNTTLIDLMADDQTVEIFDPENKLVPFTLSRKAAEFRAAKIGQYV
VRYIDQETRNFIAARTINVFDPSMVKIVEVGEAYCHKPASLVVSTNEAGQGTLTSMVRCG
GLEVPHSIRGTANGGVWEIVYHPTRVAPHKIMILYNQVPISNKAIEINVLAPAMSKEITV
NGLGLYQARVGKTTSFAIDTVGHPAREFDVVVSGPGGQALPVRCYQTKGGHLQAEFTVQK
VGQCLIDVLHQSKPLMGSPYTCESYDPTKIQLQKVPKMNLCANSPISWIVQSESAGVAEI
EVTVLSPTGQNVPVKLTQQDDYEHSIEFVPQAAGHYKATVMYGGEAVPNSPITFAVQSAG
GKSDSHASGNGLEVAHRGKETSFVVFCPTAPNVQIERTDEQAERIEPRIKNMGNNQWKIF
YTILTVGRYEIRASCTNRGPLPGSPWNIACLDPAKVTPIGGWGSCLDSSGKLVLPSKIVF
DTSMAGPGELTCYVDDAEVMVEKQGSGKCVLFLSDDALAKGEHSFDLTWSGLPISQSPGF
VYVTGMTIGSDRVVLTGRGLTTAQVGEVSHFTIDATDALSGKPEVHMAYDDGEPLPVTLL
QPRPNELIWLASYNPHKSTGGPLSLEVEWNGRIIKGCPLTIPVGPAVDAAKVLCSGEGLR
NGVVGREIKSWIDTRRAGPGELTAHCAGPRKVAYCELYDHGDATFTLNVKPQEPGRHTLT
IKYGGQHVPGSPYTLRVVGAPDASKVRVYGPGIEHGVLATFQSRFIVDTRGAGAGQLTVR
VRGPKGAFRVEMQRESQKDRTILCKYDPTEPGDYRVEVKWAGELVPGSPFPVLIFDTQEE
LKRFLHGN
NT seq 5247 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcaccagggctcacggctctcggtgagtccacgcggctagtgccggcgaacctg
ccggcggtttttgaggtgctgccgcccccgggcgcctcgatccgtggcagcgactgcgtc
gccaccgtgctctccccgagcaagaccaaagtgtccgcccgggtgacgcacgagtcggcc
aacggttcgctccggatcgagttcgtcccgtcggaggtcggcacgcacattatcgaagca
tcgatcgggggtaccaccctcgtgggcggtccgctcatcgccaaggtgtacgactcgagc
ctgatccaggtgacggacgtgaacggcggtgtcgttgggcagccgtgccagttccgtgtc
gacgcgagcgcagccggcgaaggacagctggaaatttcgatcaacgaaggcgaagtgcca
aaccatgtgcaggtggtgggcggtggccgctgcttggtgtcgttcacgcccgagcaagcc
aaaccgcatctgatcgatatcaagtttaacggtgaaacggttatcggctgcccgttcgtg
tgctcggtcgccgatacgagccgcgttctgctgaacctcaccaatctggagctgatcccg
gtcaaccggccggcctcgtttcacatcaccgtcagcggtggtggtgcggccgagctggcc
gtcagtgtgcgcggaccgcagggtgagctgccggtgcgcgtaaccggcgacatccatgcc
gggtttacggccgaatttacgccgaaccatgtcggcgcgcacacgatcaacgtcgagtac
aatggctatccggtgcagggcacaccgttcgtggcgaaatcgtacgacgccaccaaggtg
gcggtcgggtccgtgtccaagggtacggtcggccggccggtacagttcaccgtcgatgcg
ggcgacgcgggcgaaggcaacctcgagataacgatctcggccaagggccacaacattccc
acgcaggtgcatccgcagggaaatgccaaattcgccgtctcgttcgtgccggccgaaccg
tgcgagcacatcatcaacgtgtcgttcaacaaaatgcttgtccccggctgcccgatcacc
gtcatcatcaacggcggcacgaccgggccgcaggtgtcgctcggcgggcccggcccgctc
cacatgcccaactcgctggtcatcaaccacgccggaggccgcctggaggacatcgaagtg
aacgtcgaaggcccctccggtcattcggtaccggcgcaggtcttacagacggccgacggt
gtgtttaaggccgagtttgtaccgcgcgttgtcggcgagcatcgggtcagcgtaaccgtc
gagggacagccgaccgtcggcagcccgtactcagcgaaggtctacgacgttaccgcgatc
aaggtaaagaacgttaacaatggaaccgtcgggaagccggtcgtattcttggtcgaaaca
tcccaggccggaccgggcaatctggaggtgacggtcaatggcggccgcgtaccaacgtcc
gcccaggcgcagggtcaacacacttacgcgatcagcttcacgccccgcgaggcacagaac
cacacggtcgagctgcggttcaacgggcaggacgtgccgggcagtccgttcacctgtaag
gtatcgccagccgcccgcatcgtgagcagcgatctgaccgacaaggtaagcgtcggccat
acgtttgactttgtcgtcgagtccgacattgcgcccgtggtggaagtgctcggccctgcc
cgtcgtcccgtccgggccgacattgtcccggcggcctccccatcgtccggctatcgggtc
aagttcgaaccggtcgaggtcggtgaccactcggtcgaggtacggctgccgggcagcggt
cacgtcgagggcagccccttcctgctgaaagcgtactccgccgagaaggtggtcgtcacg
gacatacggcccggtgtcgtcggcaaaagtgtcagcttcggcatcaacgcgagccaggct
ggggcgggcaatctggagatcatcgttgcggtgggcggcaagaacgtgcccaactttgtc
cagtccgagggaaacgcacggttcaaggtaaactttaagccgacggaagcggccacccat
tcgctgtcggtgcggttcaatggctacccggtgccggggtcaccgttcgcctgccacgtc
acgcatgcgcccgtttccctctcgaaagcgatcgcgaccggcgagtgtctgcggcaggca
ccggtcaaggcggagagcgtgttcgagctggagggcttcgacgggatcgatccgcaggtg
ctgataacggccccgtccggcgacaccgtcacgtcgcgcgtcagcttccgcgacgaggtg
catctggtcgcgttcgtgccgacgtccgtcgggcgtcatctgattagcgtcaccgcgaac
gatcagcacatcaacggatcaccgttctcgtgcaacgtgttcgatgtgtctcgcgtatcg
atcagtgggctggatccgcgcagcacgatggcttcgctcggggtgccgctgacgtttagc
gtcgatgcggccggtgccggcgagggaacgctggagcttgtcgtgtccaccgcaaccagc
acggtgaaggcggaggtgacggcctgcgcccgcgggctgtacgacgtcacgttcataccg
cagagctgcgagccgcactttgtcaacatcacgttcaacgatctgccggtcgagggcagc
ccgttccggtgcgaggtgcagcagaacacgcagcacgtgcaggtgggcaacacgaccctg
atcgatctgatggcggacgaccagacggtggagatattcgacccggagaacaagctcgtc
ccgttcacgctgtcgcgcaaggcggccgagtttcgggcggccaagattggccagtacgtg
gtgcggtacatcgaccaggagacgcgcaacttcattgcggcccgcacgatcaacgtgttc
gacccgtcgatggtgaagattgtggaggtcggcgaggcgtactgccacaagccggcgtcg
ctcgtggtgtcgacgaacgaggcgggacagggtacgctcacgtcgatggtacgatgcggt
gggctggaggtaccgcattcgatccgcggcacggccaatgggggcgtgtgggagatcgtg
taccatccgacgcgcgtcgccccgcacaagatcatgatcctgtacaaccaggtgccgatc
tcgaacaaagccatcgaaatcaatgtcctggcgccggcgatgagcaaggagatcactgtg
aacgggttggggttgtatcaggcgcgcgttggcaagacgacctcgttcgcgatcgacacc
gttggccatccggcgcgtgagttcgatgtcgttgtgtcgggcccgggcggtcaggcactg
cccgttcgatgctaccagaccaagggaggtcatttgcaggccgagttcaccgtccagaaa
gttggtcaatgtttgattgatgttctccatcaatcgaaaccattgatgggcagtccgtac
acgtgcgaatcgtacgatccgaccaagattcagctgcagaaggtgccgaagatgaacctt
tgcgccaactcgcccatctcgtggatagtgcaatcggaatcggccggtgtggccgagatc
gaggtgaccgtactgtcacccaccggccagaacgtccccgtgaagctgacccagcaggat
gactacgagcattcgatcgagttcgtaccgcaggcggccggacactacaaggccacggtc
atgtacggcggtgaggcggtcccgaacagccccatcacgttcgccgtccagtcggccggt
ggcaagagcgacagccacgcatcgggcaacgggctggaggtggcccaccggggcaaggag
acctcgttcgtcgtgttctgcccgaccgcaccgaacgtgcagatcgagcggaccgacgag
caggcggagcgcatcgagccgcgcatcaaaaacatgggcaacaaccagtggaagatcttc
tacacgatcctcaccgtcggccggtacgagatacgggcgagctgcacgaaccgcggcccc
ctgcccggttcgccctggaacattgcctgtctcgatccggccaaggtcacgccgatcggt
ggctggggctcctgtctggacagcagcgggaagctggtgctgccgagcaagatcgtgttc
gacactagcatggccggaccgggcgaactcacctgctacgtggacgatgccgaggtgatg
gtggaaaagcagggcagcggaaaatgcgtcctcttcctttccgacgacgcgctggccaag
ggtgagcacagcttcgacctgacctggtccgggctgcccatctcgcagagtcccggtttc
gtgtacgtcaccggcatgacgatcggctccgaccgggtagtgctaaccgggcgcggtctc
accacggcccaggtcggcgaagtgtcccacttcacgatcgacgcaacggacgccctgtcc
ggcaagccggaggtgcacatggcgtacgatgacggtgaaccgctccccgtgacgctgctc
cagccccgcccgaacgaactgatctggctggcatcgtacaacccgcacaaatcgaccgga
ggccccctcagcctcgaggtggaatggaacggacgcattatcaagggctgccccctaacg
ataccggtcggaccggccgtcgatgcagcgaaagtgctctgctctggcgagggtctgcgc
aatggcgtcgtggggcgggagatcaaatcctggatcgatacgcgccgcgcagggccgggc
gaactgacagcccactgtgccgggccgcgcaaggttgcgtactgcgagctgtacgatcat
ggcgacgcgacgtttacgctcaatgtgaaaccgcaggaacctggccgccatacgctcacg
atcaagtacggtgggcagcacgtgcccggatcgccgtacacgctgcgggtcgtcggggcg
ccggacgcaagcaaggtgcgcgtgtacgggccgggcatcgagcacggtgtgctggcgacg
ttccagtcgcggttcatcgtggatacgcgcggtgccggcgccggccagctgacggtgcgc
gtccgcggcccgaagggtgcgttccgggtggagatgcagcgcgaaagtcaaaaggaccga
accatcctgtgcaagtacgatcccaccgaaccgggcgactatcgggtggaggtcaagtgg
gccggcgagctcgtgcccggttcgcccttccccgtgctcatcttcgacacgcaggaggag
ctgaaacgatttctacacggcaactaa

DBGET integrated database retrieval system