KEGG   Anopheles gambiae (mosquito): AgaP_AGAP007172Help
Entry
AgaP_AGAP007172   CDS       T01036                                 

Definition
AGAP007172-PB
Orthology
K03259  
translation initiation factor 4E
Organism
aga  Anopheles gambiae (mosquito)
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Class
Genetic Information Processing; Translation; RNA transport [PATH:aga03013]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:aga04150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2L
AA seq 254 aa AA seqDB search
MYSGRIAFQKPSSLGRLHSWPDRNGPNGRWNNSLRVVVPANNYLSQQQQQNENETTEQSQ
ELAEQSNAPESIDPECLIKHPLQHTWTLWYLEVDRTKKWTDSMNEVTSFSTVEDFWSLFN
HIRGPSEIKVGGDYMLFKSHIRPMWEDDANKHGGRWTISMNKRLSDKCWLDTVLCLIGET
FEHSDQICGATVNVRQKIDKISIWTADYDNRAAVLDIGRTYKERLGLRENIYYQMHKDTM
VKLSSSGTKSTYTV
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgtacagtggaaggatcgcttttcagaagccttcctccttgggaaggcttcacagctgg
cccgatcgtaacgggccgaacggacgttggaacaacagcttgagagtagtagtgccggct
aataattacctttcccagcagcagcagcagaatgaaaatgaaactacggaacagagccag
gagctggccgagcagtcgaacgcaccggagtcgatcgatccggagtgtctgatcaagcat
ccgctccagcacacctggacgctgtggtacctcgaggtggaccgcacgaaaaagtggacc
gattcgatgaatgaggtgaccagcttctcgacggtggaggacttctggagcctgttcaat
cacatccgcggcccgtccgagatcaaggtgggcggtgactacatgctgttcaagtctcac
atccgcccgatgtgggaggacgacgcgaacaagcacggtggccgatggacgatcagcatg
aacaagcgcctgtcggacaaatgctggctggatacggtactctgcttgattggagagact
ttcgaacattcggatcagatctgcggtgctacggtgaacgttcgtcaaaagattgataaa
atctccatctggaccgctgactatgataatcgtgccgccgtgctggatatcggccgaacg
tacaaggagcgattaggcctgcgagaaaacatctactaccaaatgcataaggacacgatg
gtgaagctgtcctcgtcggggacgaaatcgacgtacaccgtttaa

DBGET integrated database retrieval system