KEGG   Anopheles gambiae (mosquito): AgaP_AGAP007172Help
Entry
AgaP_AGAP007172   CDS       T01036                                 

Definition
AGAP007172-PB
Orthology
K03259  
translation initiation factor 4E
Organism
aga  Anopheles gambiae (mosquito)
Pathway
RNA transport
mTOR signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:aga00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AgaP_AGAP007172
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    AgaP_AGAP007172
Translation factors [BR:aga03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    AgaP_AGAP007172
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2L
AA seq 254 aa AA seqDB search
MYSGRIAFQKPSSLGRLHSWPDRNGPNGRWNNSLRVVVPANNYLSQQQQQNENETTEQSQ
ELAEQSNAPESIDPECLIKHPLQHTWTLWYLEVDRTKKWTDSMNEVTSFSTVEDFWSLFN
HIRGPSEIKVGGDYMLFKSHIRPMWEDDANKHGGRWTISMNKRLSDKCWLDTVLCLIGET
FEHSDQICGATVNVRQKIDKISIWTADYDNRAAVLDIGRTYKERLGLRENIYYQMHKDTM
VKLSSSGTKSTYTV
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgtacagtggaaggatcgcttttcagaagccttcctccttgggaaggcttcacagctgg
cccgatcgtaacgggccgaacggacgttggaacaacagcttgagagtagtagtgccggct
aataattacctttcccagcagcagcagcagaatgaaaatgaaactacggaacagagccag
gagctggccgagcagtcgaacgcaccggagtcgatcgatccggagtgtctgatcaagcat
ccgctccagcacacctggacgctgtggtacctcgaggtggaccgcacgaaaaagtggacc
gattcgatgaatgaggtgaccagcttctcgacggtggaggacttctggagcctgttcaat
cacatccgcggcccgtccgagatcaaggtgggcggtgactacatgctgttcaagtctcac
atccgcccgatgtgggaggacgacgcgaacaagcacggtggccgatggacgatcagcatg
aacaagcgcctgtcggacaaatgctggctggatacggtactctgcttgattggagagact
ttcgaacattcggatcagatctgcggtgctacggtgaacgttcgtcaaaagattgataaa
atctccatctggaccgctgactatgataatcgtgccgccgtgctggatatcggccgaacg
tacaaggagcgattaggcctgcgagaaaacatctactaccaaatgcataaggacacgatg
gtgaagctgtcctcgtcggggacgaaatcgacgtacaccgtttaa

DBGET integrated database retrieval system