KEGG   Anopheles gambiae (mosquito): AgaP_AGAP007294Help
Entry
AgaP_AGAP007294   CDS       T01036                                 

Gene name
IAP1
Definition
(RefSeq) AGAP007294-PA
  KO
K16061  
baculoviral IAP repeat-containing protein 7/8
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Ubiquitin mediated proteolysis
Apoptosis - multiple species
Brite
KEGG Orthology (KO) [BR:aga00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    AgaP_AGAP007294 (IAP1)
 Cellular Processes
  Cell growth and death
   04215 Apoptosis - multiple species
    AgaP_AGAP007294 (IAP1)
Ubiquitin system [BR:aga04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    AgaP_AGAP007294 (IAP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2L
AA seq 369 aa AA seqDB search
MAHALSLPAPPIDLPDNKHKDDDLACMSPEYFHIEENRLRSFTSRWPVTFISPNVLARYG
FYYVGTDDTVKCYFCRVEIGLWEPQDDVIQEHLRWSPYCPLLKKRPTNNVPLNANYLDAV
PEPSFDTCGISVRHNSYAENADDRVRIDLDRLSGDSWSGASDISLSSAAGAAAASAGESE
PMPSVGSGYPNYAIEADRLKSYEDWPTSLKQKPQQLSDAGFFYTGMSDRVKCFSCGGGLK
DWEQEDDPWQQHAIWYSNCHYLQLMKGREFIQKCNELKEAASASSAASTSSAMSSASSQP
STDEGEDDAGGDRRVPSDGKICKICFVNEYNTAFMPCGHVVACAKCASSVSKCPLCQQPF
INVLRLYLS
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggcccatgcactatcgctacccgccccaccgatcgacctgcccgacaacaagcacaag
gatgacgatctcgcctgcatgtcaccggagtacttccacatcgaggagaaccggttacgc
agcttcacctcccgctggccggtcacgttcatcagcccgaacgtgctggcccggtacggg
ttttactacgtcggcaccgatgacacggtcaagtgttacttctgccgggtggagatcggg
ctgtgggaaccgcaggacgacgtgatccaggagcatctgcgctggtcgccgtactgtccg
ctgctgaagaagcgccccaccaacaacgtgccgctgaacgcgaactatctcgatgccgtg
ccggagccgagcttcgacacctgcggcatcagcgtgcggcacaattcgtacgcggagaat
gccgacgatcgggtgcggatagatttggaccggctgagcggcgattcgtggagcggggcg
agcgatatcagtctgagcagtgccgctggtgcagcggctgcttccgccggggagagcgag
ccgatgccgtcggtcgggagtggatacccgaactacgcgatcgaggcggaccggctgaag
tcgtacgaggactggccgacgtcgctgaagcagaaaccgcagcagctgagcgacgctggc
ttcttctacacgggcatgagcgaccgcgtcaagtgcttcagctgtggcggtgggctgaag
gactgggagcaggaggacgacccgtggcagcagcacgcgatctggtacagcaactgccac
tacctgcagctgatgaagggccgcgagttcattcagaagtgcaacgagctgaaggaggcg
gcttccgcctcctccgctgccagcacatcttccgcgatgtcttccgcctcgtcccagccg
tccactgacgagggcgaggacgatgcgggtggcgatcggcgcgtaccgtccgacggtaag
atctgcaagatctgcttcgtcaacgagtacaacaccgcgttcatgccgtgcgggcacgtc
gtcgcctgcgccaagtgcgcatcgtccgtcagcaagtgtccgctctgtcagcaaccgttc
atcaacgtgctacggctgtacctgtcgtaa

DBGET integrated database retrieval system