KEGG   Anopheles gambiae (mosquito): AgaP_AGAP007294Help
Entry
AgaP_AGAP007294   CDS       T01036                                 

Gene name
IAP1
Definition
AGAP007294-PA
Orthology
K04725  
E3 ubiquitin-protein ligase XIAP
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:aga04120]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2L
AA seq 369 aa AA seqDB search
MAHALSLPAPPIDLPDNKHKDDDLACMSPEYFHIEENRLRSFTSRWPVTFISPNVLARYG
FYYVGTDDTVKCYFCRVEIGLWEPQDDVIQEHLRWSPYCPLLKKRPTNNVPLNANYLDAV
PEPSFDTCGISVRHNSYAENADDRVRIDLDRLSGDSWSGASDISLSSAAGAAAASAGESE
PMPSVGSGYPNYAIEADRLKSYEDWPTSLKQKPQQLSDAGFFYTGMSDRVKCFSCGGGLK
DWEQEDDPWQQHAIWYSNCHYLQLMKGREFIQKCNELKEAASASSAASTSSAMSSASSQP
STDEGEDDAGGDRRVPSDGKICKICFVNEYNTAFMPCGHVVACAKCASSVSKCPLCQQPF
INVLRLYLS
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggcccatgcactatcgctacccgccccaccgatcgacctgcccgacaacaagcacaag
gatgacgatctcgcctgcatgtcaccggagtacttccacatcgaggagaaccggttacgc
agcttcacctcccgctggccggtcacgttcatcagcccgaacgtgctggcccggtacggg
ttttactacgtcggcaccgatgacacggtcaagtgttacttctgccgggtggagatcggg
ctgtgggaaccgcaggacgacgtgatccaggagcatctgcgctggtcgccgtactgtccg
ctgctgaagaagcgccccaccaacaacgtgccgctgaacgcgaactatctcgatgccgtg
ccggagccgagcttcgacacctgcggcatcagcgtgcggcacaattcgtacgcggagaat
gccgacgatcgggtgcggatagatttggaccggctgagcggcgattcgtggagcggggcg
agcgatatcagtctgagcagtgccgctggtgcagcggctgcttccgccggggagagcgag
ccgatgccgtcggtcgggagtggatacccgaactacgcgatcgaggcggaccggctgaag
tcgtacgaggactggccgacgtcgctgaagcagaaaccgcagcagctgagcgacgctggc
ttcttctacacgggcatgagcgaccgcgtcaagtgcttcagctgtggcggtgggctgaag
gactgggagcaggaggacgacccgtggcagcagcacgcgatctggtacagcaactgccac
tacctgcagctgatgaagggccgcgagttcattcagaagtgcaacgagctgaaggaggcg
gcttccgcctcctccgctgccagcacatcttccgcgatgtcttccgcctcgtcccagccg
tccactgacgagggcgaggacgatgcgggtggcgatcggcgcgtaccgtccgacggtaag
atctgcaagatctgcttcgtcaacgagtacaacaccgcgttcatgccgtgcgggcacgtc
gtcgcctgcgccaagtgcgcatcgtccgtcagcaagtgtccgctctgtcagcaaccgttc
atcaacgtgctacggctgtacctgtcgtaa

DBGET integrated database retrieval system