KEGG   Anopheles gambiae (mosquito): AgaP_AGAP007294Help
Entry
AgaP_AGAP007294   CDS       T01036                                 

Gene name
IAP1
Definition
(RefSeq) AGAP007294-PA
  KO
K04725  
E3 ubiquitin-protein ligase XIAP [EC:2.3.2.27]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:aga00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    AgaP_AGAP007294 (IAP1)
Enzymes [BR:aga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     AgaP_AGAP007294 (IAP1)
Ubiquitin system [BR:aga04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    AgaP_AGAP007294 (IAP1)
Mitochondrial biogenesis [BR:aga03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Retention of mitochondria
    AgaP_AGAP007294 (IAP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2L
AA seq 369 aa AA seqDB search
MAHALSLPAPPIDLPDNKHKDDDLACMSPEYFHIEENRLRSFTSRWPVTFISPNVLARYG
FYYVGTDDTVKCYFCRVEIGLWEPQDDVIQEHLRWSPYCPLLKKRPTNNVPLNANYLDAV
PEPSFDTCGISVRHNSYAENADDRVRIDLDRLSGDSWSGASDISLSSAAGAAAASAGESE
PMPSVGSGYPNYAIEADRLKSYEDWPTSLKQKPQQLSDAGFFYTGMSDRVKCFSCGGGLK
DWEQEDDPWQQHAIWYSNCHYLQLMKGREFIQKCNELKEAASASSAASTSSAMSSASSQP
STDEGEDDAGGDRRVPSDGKICKICFVNEYNTAFMPCGHVVACAKCASSVSKCPLCQQPF
INVLRLYLS
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggcccatgcactatcgctacccgccccaccgatcgacctgcccgacaacaagcacaag
gatgacgatctcgcctgcatgtcaccggagtacttccacatcgaggagaaccggttacgc
agcttcacctcccgctggccggtcacgttcatcagcccgaacgtgctggcccggtacggg
ttttactacgtcggcaccgatgacacggtcaagtgttacttctgccgggtggagatcggg
ctgtgggaaccgcaggacgacgtgatccaggagcatctgcgctggtcgccgtactgtccg
ctgctgaagaagcgccccaccaacaacgtgccgctgaacgcgaactatctcgatgccgtg
ccggagccgagcttcgacacctgcggcatcagcgtgcggcacaattcgtacgcggagaat
gccgacgatcgggtgcggatagatttggaccggctgagcggcgattcgtggagcggggcg
agcgatatcagtctgagcagtgccgctggtgcagcggctgcttccgccggggagagcgag
ccgatgccgtcggtcgggagtggatacccgaactacgcgatcgaggcggaccggctgaag
tcgtacgaggactggccgacgtcgctgaagcagaaaccgcagcagctgagcgacgctggc
ttcttctacacgggcatgagcgaccgcgtcaagtgcttcagctgtggcggtgggctgaag
gactgggagcaggaggacgacccgtggcagcagcacgcgatctggtacagcaactgccac
tacctgcagctgatgaagggccgcgagttcattcagaagtgcaacgagctgaaggaggcg
gcttccgcctcctccgctgccagcacatcttccgcgatgtcttccgcctcgtcccagccg
tccactgacgagggcgaggacgatgcgggtggcgatcggcgcgtaccgtccgacggtaag
atctgcaagatctgcttcgtcaacgagtacaacaccgcgttcatgccgtgcgggcacgtc
gtcgcctgcgccaagtgcgcatcgtccgtcagcaagtgtccgctctgtcagcaaccgttc
atcaacgtgctacggctgtacctgtcgtaa

DBGET integrated database retrieval system