KEGG   Anopheles gambiae (mosquito): AgaP_AGAP007300Help
Entry
AgaP_AGAP007300   CDS       T01036                                 

Definition
AGAP007300-PA
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aga00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    AgaP_AGAP007300
Enzymes [BR:aga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     AgaP_AGAP007300
Exosome [BR:aga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AgaP_AGAP007300
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2L
AA seq 571 aa AA seqDB search
MKECFVCSRTVLVLVIVIVSVHRPHHPNALELLGAADSLQPRAAASANVTESESVHPPPA
ATIAEERSTPEETGNEAHHRQKRLVSAGEYEKTAQYWNIGAQLKLKEHLMRQPNRNIAKN
VVFFLGDGMSIPTLAASRMYLGQQQGHTGEESQLSFEEFPDVGLVKTYCVDKQVADSACT
STAYLCGVKANYATLGVTAAVNYGNCAASNDPRNQVESIMAWAQAAGKATGIVTTTRVTH
ASPAGAYAHTSNRDWECDADIVRSGGDPAQCPDIATQLIYGDTGKQFRVILGGGRRKFLP
RTMKDEEGIRGQRMDGANLISQWYYGKPLGTARYVSNRQELMALNFTEVDYLLGLFAADH
LKFHLDARPDLDPTLGDLTYAAIRTLEKYPEGYVLFVEGGKIDLAHHFTKARKSLDETVQ
LSEAVQVARQLTTQDDTLLVVTADHSHTMTLSGYATRGNDILGLNSQISDGDRKPYTTLA
YANGPGGPVPGPKGQRPNITESMIKDRDFQFPKVVPMKYETHGGDDVALFAYGPWSHLFG
GMYEQNVIPHLIGYAACIGNGEHACSTVGSL
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgaaagagtgttttgtgtgttcgcgtaccgtactggtgctagtcattgtgatcgtctcc
gtacaccgaccccaccatcctaacgcactggaacttctcggtgcggcagattctctacag
ccaagagcagcggcgagcgcgaatgtgaccgaaagtgaaagtgttcatccgccaccggca
gcaaccattgccgaggaacgttccaccccggaagagaccggcaatgaagcgcaccatcgg
caaaagcggctcgtgtcggccggtgagtacgagaagacggctcagtactggaacattggg
gcgcagctgaagctgaaggagcacctgatgcgacagccgaaccgtaatattgctaaaaat
gtggtcttcttcctcggtgacggcatgtcgataccgacgctcgcggccagccgtatgtat
ctcgggcagcagcaaggtcatacgggcgaggaaagccagctgtcgttcgaagagtttccc
gacgttggtctcgtgaagacctactgtgtggataaacaggtagccgattctgcctgcacc
tcgacggcttatctgtgcggcgtcaaggccaactatgcaacgctcggtgtaacggctgcc
gtcaactatggtaactgtgctgctagcaatgatccccgcaaccaggtcgaatcgatcatg
gcctgggctcaggcagcgggcaaagcaaccggaatcgttaccaccacccgtgtaacgcac
gccagccctgccggtgcctacgcccatacctccaaccgtgactgggaatgtgatgccgat
attgtgcgatcgggtggcgatccggctcaatgtcccgatatcgccacgcagctgatttac
ggcgacacgggcaaacagtttcgcgttatccttggtggtggccgtcgcaagttcctgccg
cgtacgatgaaagacgaggaaggtatccgcggacagcgaatggatggtgctaatctgatt
tcccagtggtactatggtaaaccgctcggcacggcacggtacgtgtcgaaccggcaggag
ctgatggcgctcaactttaccgaggtggactacttgctcggcctgttcgcggcggaccat
ctgaagtttcatctcgatgcccgtcccgacttggatccaacgttgggcgatctgacgtac
gccgcgatacgaacgctggagaagtaccccgagggctacgtgctgtttgtggagggtggc
aaaattgatctggcccatcacttcaccaaggcacgtaaatcgctcgacgagacggtacag
ctgtcggaggcggtgcaggtagcgcggcagctcaccacgcaggacgatacgctgctcgtc
gtgacggcggaccattctcacacgatgacactgtcggggtacgcgacacgtgggaacgac
attcttggcctgaacagccagatcagcgacggggataggaaaccgtacacgacgctagcg
tacgcgaacggaccgggcgggccggtgccgggcccgaagggccagaggccaaacattacc
gagtcgatgataaaggaccgagacttccaatttccgaaggtggtgccgatgaagtacgaa
acgcacggtggcgacgatgtggcactgttcgcgtacggaccgtggtcgcatctgttcggt
ggaatgtatgagcaaaatgttataccacacctgatagggtacgcggcgtgcatcgggaac
ggggagcacgcgtgttcgacggttggcagtttgtaa

DBGET integrated database retrieval system