KEGG   Anopheles gambiae (mosquito): AgaP_AGAP007347Help
Entry
AgaP_AGAP007347   CDS       T01036                                 

Gene name
LYSC1_ANOGA
Definition
AGAP007347-PA
Orthology
K13915  
lysozyme C [EC:3.2.1.17]
Organism
aga  Anopheles gambiae (mosquito)
Brite
Enzymes [BR:aga01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     AgaP_AGAP007347 (LYSC1_ANOGA)
Exosome [BR:aga04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AgaP_AGAP007347 (LYSC1_ANOGA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2L
AA seq 140 aa AA seqDB search
MKVFSTVLLAIVACCAVAEAKTFGKCELAKALANNGIAKASLPDWVCLVQNESAFSTSAT
NKNKNGSTDYGIFQINNKYWCDSGYGSNDCKIACKNLLNDDITDDIKCAKLIHKRHGFNA
WYGWKNHCNGKKLPNVSSCF
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtgttttccacagttttgctcgccatcgtcgcgtgttgtgccgtagccgaagct
aaaacgttcggcaaatgtgaactggcaaaggcgctggccaacaatggtatcgcgaaagca
tcgttgccggattgggtctgtctggtgcagaacgagagtgcgttcagcacatcggcgaca
aacaagaacaagaacggttcgaccgattacggcatcttccagatcaacaacaagtactgg
tgcgattcgggctacggttcaaacgactgcaagatcgcgtgcaaaaatttactaaacgac
gatattacggatgacatcaagtgtgccaagctgatccacaaacgtcatggatttaacgcc
tggtacggctggaagaaccactgcaatggcaagaagctgccgaatgttagctcctgtttt
taa

DBGET integrated database retrieval system