KEGG   Anopheles gambiae (mosquito): AgaP_AGAP007393Help
Entry
AgaP_AGAP007393   CDS       T01036                                 

Definition
AGAP007393-PA
Orthology
K08056  
protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:aga00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    AgaP_AGAP007393
Enzymes [BR:aga01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     AgaP_AGAP007393
Exosome [BR:aga04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   AgaP_AGAP007393
  Exosomal proteins of colorectal cancer cells
   AgaP_AGAP007393
  Exosomal proteins of bladder cancer cells
   AgaP_AGAP007393
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2L
AA seq 488 aa AA seqDB search
MSCRLLLVCLCALVAVAFAGEADVLDLTDSDFSTRVAETETTLVMFYAPWCGHCKKLKPE
YAKAAELLRGEDPPIALAKVDCTEGGKDTCNKFSVSGYPTLKVFKNGEVSQEYNGPREAT
GIAKYMKSIVGPASKDLLTVEAFEAFLKVQETSVVGFFQKESELKGVFLKYADSQRERLR
FGHSSAPAVLEKQGETDAVFLFRARQLANKFEPDFVKFEGTTKQELADFVKANFHGLAGV
RSRDTTSDFKNPLVVVYYAVDYVKNPKGTNYWRNRVLKVAKEFVGRVNFAVSAKDDFQHE
LNEYGYDYTGDKPLVLARDAKNQKFIMKDEFSVENLQAFATELEEGSLEPYVKSEPVPES
NDGPVKVAVAKNFDEVVVNNGVDTLVEFYAPWCGHCKKLTPTLEELGTKLKDEAVSIVKM
DATANDVPPQFEVRGFPTLYWLPKDAKSSPARYEGGREVDDFVKYIAKHATSELKGFDRA
GGAKKTEL
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgagctgccggttgctgctggtttgtctgtgtgccctggtggcggtggcgtttgccggt
gaagccgacgtgctggatctgaccgatagcgatttttcgacccgcgtcgcggagacggaa
accacccttgtgatgttctacgcaccatggtgcggacactgcaaaaagctcaagcccgag
tatgccaaggcagcggagctgctacgtggcgaagatcctccgatcgcgctggccaaggtc
gactgtaccgagggcggtaaggacacgtgtaacaagttcagcgtcagcggctatcccacc
ctgaaggtgttcaagaacggcgaggtgtcgcaggagtacaacggcccgcgcgaagcgacc
ggcattgccaagtacatgaaatcgatcgtcggaccggcctcgaaggatctgctgacggtg
gaagcgttcgaagcgttcctgaaggtgcaggaaacgtccgtggtcgggttcttccagaag
gagtcggagctgaagggtgtcttcctgaagtacgctgacagccagcgcgagcggctacgc
ttcggtcacagcagtgcgccggccgtactggagaagcagggcgaaaccgatgccgtattc
ctgttccgtgcccgccagcttgccaacaagtttgagccggactttgtcaagttcgaggga
accaccaagcaggagctggccgacttcgtgaaggccaacttccacgggctggccggagtg
cgttcgcgcgacactacgagcgacttcaagaacccgctggtggtcgtgtactacgcggtg
gactacgtgaagaacccgaagggcaccaactactggcgcaaccgtgtgctgaaggtggcg
aaggagttcgtcggacgcgtcaactttgccgtgagcgccaaggatgacttccagcacgag
ctgaacgagtacgggtacgattacaccggcgacaagccgctggtgctggcccgcgacgcc
aagaaccagaagttcatcatgaaggacgaattctcggtggagaatctgcaggcgttcgcg
accgagctggaggagggctcgctggaaccgtacgtcaagtcggaaccggtgccggaaagc
aacgacggaccggtgaaggttgccgtggccaagaactttgacgaggtggtcgtgaacaac
ggtgtcgacacgctggtcgagttctacgcaccgtggtgcggacactgcaagaagctcacc
ccgacgctggaggagctgggcaccaagctgaaggatgaggccgtttcgatcgtgaagatg
gatgccaccgccaacgatgtgccgccccagtttgaggtgcgcggcttcccgaccctctac
tggttgccgaaggacgccaagagctccccggcccgttacgagggtggccgcgaggtggac
gacttcgtgaagtacattgccaagcacgcgacgagcgagctgaagggcttcgaccgtgcc
ggcggcgcgaagaagaccgagctgtaa

DBGET integrated database retrieval system