KEGG   Anopheles gambiae (mosquito): AgaP_AGAP007393Help
Entry
AgaP_AGAP007393   CDS       T01036                                 

Definition
(RefSeq) AGAP007393-PA
  KO
K08056  protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
aga04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:aga00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    AgaP_AGAP007393
Enzymes [BR:aga01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     AgaP_AGAP007393
Chaperones and folding catalysts [BR:aga03110]
 Protein folding catalysts
  Protein disulfide isomerase
   AgaP_AGAP007393
Membrane trafficking [BR:aga04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    AgaP_AGAP007393
Exosome [BR:aga04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   AgaP_AGAP007393
  Exosomal proteins of colorectal cancer cells
   AgaP_AGAP007393
  Exosomal proteins of bladder cancer cells
   AgaP_AGAP007393
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_2 Thioredoxin_8 Thioredoxin_7 AhpC-TSA Redoxin Glutaredoxin TraF OST3_OST6
Motif
Other DBs
NCBI-GeneID: 1269789
NCBI-ProteinID: XP_001687942
VectorBase: AGAP007393
UniProt: Q5TWW9
Position
2L
AA seq 488 aa AA seqDB search
MSCRLLLVCLCALVAVAFAGEADVLDLTDSDFSTRVAETETTLVMFYAPWCGHCKKLKPE
YAKAAELLRGEDPPIALAKVDCTEGGKDTCNKFSVSGYPTLKVFKNGEVSQEYNGPREAT
GIAKYMKSIVGPASKDLLTVEAFEAFLKVQETSVVGFFQKESELKGVFLKYADSQRERLR
FGHSSAPAVLEKQGETDAVFLFRARQLANKFEPDFVKFEGTTKQELADFVKANFHGLAGV
RSRDTTSDFKNPLVVVYYAVDYVKNPKGTNYWRNRVLKVAKEFVGRVNFAVSAKDDFQHE
LNEYGYDYTGDKPLVLARDAKNQKFIMKDEFSVENLQAFATELEEGSLEPYVKSEPVPES
NDGPVKVAVAKNFDEVVVNNGVDTLVEFYAPWCGHCKKLTPTLEELGTKLKDEAVSIVKM
DATANDVPPQFEVRGFPTLYWLPKDAKSSPARYEGGREVDDFVKYIAKHATSELKGFDRA
GGAKKTEL
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgagctgccggttgctgctggtttgtctgtgtgccctggtggcggtggcgtttgccggt
gaagccgacgtgctggatctgaccgatagcgatttttcgacccgcgtcgcggagacggaa
accacccttgtgatgttctacgcaccatggtgcggacactgcaaaaagctcaagcccgag
tatgccaaggcagcggagctgctacgtggcgaagatcctccgatcgcgctggccaaggtc
gactgtaccgagggcggtaaggacacgtgtaacaagttcagcgtcagcggctatcccacc
ctgaaggtgttcaagaacggcgaggtgtcgcaggagtacaacggcccgcgcgaagcgacc
ggcattgccaagtacatgaaatcgatcgtcggaccggcctcgaaggatctgctgacggtg
gaagcgttcgaagcgttcctgaaggtgcaggaaacgtccgtggtcgggttcttccagaag
gagtcggagctgaagggtgtcttcctgaagtacgctgacagccagcgcgagcggctacgc
ttcggtcacagcagtgcgccggccgtactggagaagcagggcgaaaccgatgccgtattc
ctgttccgtgcccgccagcttgccaacaagtttgagccggactttgtcaagttcgaggga
accaccaagcaggagctggccgacttcgtgaaggccaacttccacgggctggccggagtg
cgttcgcgcgacactacgagcgacttcaagaacccgctggtggtcgtgtactacgcggtg
gactacgtgaagaacccgaagggcaccaactactggcgcaaccgtgtgctgaaggtggcg
aaggagttcgtcggacgcgtcaactttgccgtgagcgccaaggatgacttccagcacgag
ctgaacgagtacgggtacgattacaccggcgacaagccgctggtgctggcccgcgacgcc
aagaaccagaagttcatcatgaaggacgaattctcggtggagaatctgcaggcgttcgcg
accgagctggaggagggctcgctggaaccgtacgtcaagtcggaaccggtgccggaaagc
aacgacggaccggtgaaggttgccgtggccaagaactttgacgaggtggtcgtgaacaac
ggtgtcgacacgctggtcgagttctacgcaccgtggtgcggacactgcaagaagctcacc
ccgacgctggaggagctgggcaccaagctgaaggatgaggccgtttcgatcgtgaagatg
gatgccaccgccaacgatgtgccgccccagtttgaggtgcgcggcttcccgaccctctac
tggttgccgaaggacgccaagagctccccggcccgttacgagggtggccgcgaggtggac
gacttcgtgaagtacattgccaagcacgcgacgagcgagctgaagggcttcgaccgtgcc
ggcggcgcgaagaagaccgagctgtaa

DBGET integrated database retrieval system