KEGG   Anopheles gambiae (mosquito): AgaP_AGAP007493Help
Entry
AgaP_AGAP007493   CDS       T01036                                 

Definition
AGAP007493-PA
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
aga  Anopheles gambiae (mosquito)
Brite
Enzymes [BR:aga01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     AgaP_AGAP007493
    1.3.1.94  polyprenol reductase
     AgaP_AGAP007493
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2L
AA seq 315 aa AA seqDB search
MFPWFDIRSINLINFLFANLIVTVVVLGGLLATIEKHLPTAIRQTFRYGKHALKGSPDRL
VSLLEVPKAWFKHFYVFAALWSVAGFAVMMETYLTGQPARDYVIAFLDTMATNKRMVRTT
PTETMVAMTLITLQCLRRFYETWFVQVFSSKLKINLSAYLVGYIHYFGTIVAILAQAEGF
TRAGPVSLPTNGYRFEPSVRLALCVGVFCYAWYHQYLSNVILANLRKDKAGKVVSQKHSL
PTGDYFDAVSSPHMFFEIVMYVVLFCVLHRNSTMVYVLLWVLSNQLMNSWLTHQWYVENF
PNYPKQRKALVPFVL
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgttcccgtggttcgatattcggtcgatcaatttgatcaactttctgttcgccaacctc
atcgtgacggtcgtggtgctcggtggactgttggcaacgatcgaaaagcatctgcccacc
gccatccggcagacgttccggtatggcaagcatgcgctgaaggggtcgccggaccgattg
gtatccctgctggaggtcccgaaggcgtggttcaaacatttttacgtctttgctgccctc
tggtcggtggccggatttgccgtcatgatggagacctacctcactggccagccagcgcgg
gactacgtaatcgccttcctcgacacgatggcaaccaacaagcgcatggtgcgcaccacg
cctaccgagacgatggttgccatgacgctgatcacgctgcagtgcttgcgccggttctac
gagacctggttcgtgcaggtgttctcgagcaagctgaaaatcaacctgtccgcgtacctc
gtcgggtacatccattacttcggtacgatcgtggcgatcctagcgcaggcggaagggttc
acccgcgctggtcccgtctcgctgcccaccaacggatatcggttcgagcccagcgtccga
ttagccctgtgcgttggcgtgttttgctacgcctggtaccaccagtacctgtcgaacgtg
atcctggccaacctgcgcaaggacaaggcgggcaaagtggtgagccagaagcacagcctg
ccaaccggcgactacttcgatgctgtatcctcgccccacatgttcttcgagatcgtgatg
tacgtcgtgctgttctgtgtgctgcaccggaacagtacgatggtgtacgtgctgctgtgg
gtcctctcgaatcagctgatgaactcgtggctcacccaccagtggtacgtggaaaacttt
cccaactatcccaagcaaaggaaagcgctcgtaccgttcgttctgtaa

DBGET integrated database retrieval system