KEGG   Anopheles gambiae (mosquito): AgaP_AGAP007521Help
Entry
AgaP_AGAP007521   CDS       T01036                                 

Definition
AGAP007521-PB
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
aga  Anopheles gambiae (mosquito)
Brite
Enzymes [BR:aga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     AgaP_AGAP007521
Peptidases [BR:aga01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   AgaP_AGAP007521
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2L
AA seq 1053 aa AA seqDB search
MPIQMVCDSTPSLVSAAIRDALHSSGGTTNGRTGGGLSNGDDGANDLVESISQSLRQGQQ
VKPITYEEGPSYNTSLDKLKSKYIVLKATTPNDSSSGGGSLGNSSSSSGSSFGAGLSSKA
STGGAPNTHLTMNGGGSLKMDTNTLPTPKRTLFPRENVQIGWKTTGRKWLVGAGMMNMGN
TCYLNSTLQALFHVPAIANWLLSDEPHRAKCDDGGSGGSCIICAMAKTLLESQSNQTAFR
PYLVYSKLRLVCKHLVPGRQEDAHEFLRYLVEAMEKSYIGRTKNSKELDQYSKETTPLNQ
ILGGYLRSEVKCLSCQHVSTTFQHFEDLLLDIRKANSIDEALELYFARERLEEMGYKCEA
CKRRVAATKQFSLERAPFVLCVQLKRFSMLGAKINKHVELRSKLDLTPYSSPAMRSNGGK
LTYRLTSMVTHLGSTQHCGHYTAIGHTDAGGYHVFDDSSVRPIGIHNVMSTNAYILFYEL
ESVAAGAVGLPNGTCRPKATVSVGQPSSTATLTSMGHLSNGSTPTGFGSGSAGGGSTSGG
GGGSGGTPGKVTNSSPLRVLGTGGGNGAAEHAHFSSPSSTASTLSNASPLCSPLKHHQQQ
QETMSGGSSKIPKLPDINARSATPLNGVQHGEAKGKSLSTPLLASMPKLPLSSPSKSLDN
GNGSTGSAVISLVPYDSDDTSSTSEDDDEDEKAHSRATIAGKSLVLTNGGASAAVKRAKP
HSSAPSLFANGKRSAKEEQDEDDGDDDDEEEEDQDDEERTSTSSSRSPQMIKTKAGLWKV
SKSSTADQLSYPDSGSASSSKSSSPTTSGVSSPTSSPGQKQQKVVPQRNGAASANGAGSR
SSSPGGEGNGSSNGNGNRNGGASAVQMLMKYSHRGYGAPVKSWNGQQTAMDRELANDRRE
ERKRQIEDDRETEMDRGRTKKTKAGTGGPNNNNNNNNSGNNGNNPFQQYQNHQTGGGGSN
GKWMGNGGNRNHFNNHHQNNYRGGGGGGGYYQNGNGHRHHGGGGNSGFRTGGRRFGGRNG
GGFHSKAHHHHQRSESGSGMAGGGGGSNGFYHR
NT seq 3162 nt NT seq  +upstreamnt  +downstreamnt
atgcccatccaaatggtttgcgattcgacaccatcgcttgtgagcgcagcaatacgggat
gcgttgcactcgtcgggcggcacaacaaatggacgaacgggcggcggtctgagcaacggg
gacgacggagcgaacgatttggtggaatccatcagccagtcgctgcgccagggacagcag
gtgaagccgatcacgtacgaggaaggtcccagctacaacaccagcttggacaagctcaag
tccaagtacatcgtcctgaaggcgacaacaccgaacgacagcagcagcggtggaggttcc
cttggcaactcctcgtcctcctccggctcttcgttcggtgctggactgtcgtcgaaagcg
tccactggtggagcgccaaacacacatctgaccatgaacggcggcggttcgctgaagatg
gacaccaacacactgccaacgccgaaacggacactcttcccgcgcgagaacgtccagatc
ggatggaaaacgaccggacgcaagtggctggtgggagccggtatgatgaacatgggcaac
acctgctaccttaactcgaccctgcaagccctgttccacgtgccggcgattgccaactgg
ttgctgtcagatgagccgcaccgggccaaatgtgatgatggcggttccggcggtagctgc
attatctgtgcgatggccaaaacgctgctcgaatcacagtccaaccagaccgcgttccgg
ccctacctggtgtactcgaagctgcggctcgtgtgcaagcatctggtgccgggccggcag
gaggatgcacacgagtttctgcgctatctggtggaggcgatggaaaagtcctacatcggc
cgaacgaagaacagcaaggagctggaccagtacagcaaggaaacgaccccgctgaaccag
atcctcggtgggtacttgcggtccgaggtgaagtgtctgtcctgccagcacgtgtcgacc
acgttccagcacttcgaggacctgctgctcgacatccggaaagcgaactcgatcgacgag
gcgctcgagctgtactttgcccgcgagcggctcgaggagatggggtacaagtgcgaggcg
tgcaagcggcgcgtcgccgccaccaagcagttctcgctcgagcgtgccccgttcgtactg
tgcgtgcagctgaagcgcttctcgatgctcggtgccaaaatcaacaagcacgtggagctg
cgctccaagctggacctcacgccgtactcgtcgcccgccatgcgctcgaacggcggcaag
cttacctaccggctgacctcgatggtgacgcatctgggaagcacgcagcactgcggccac
tacaccgccatcgggcacacggatgcgggcgggtaccacgtgttcgacgacagctccgtg
cgccccatcggcattcacaacgtgatgagcacgaacgcgtacatactgttttacgagcta
gaaagtgtggcggccggtgcggtaggcctaccgaacgggacctgccggccgaaggccacc
gtctccgtggggcagccgagcagtaccgccacgctcacgtcgatgggccacctgagcaac
gggagtacgccgaccgggttcggcagtggttccgccggtggcgggagtactagtgggggt
ggtggagggagtggtggcacgcccggaaaagtcactaattcatcgccactccgggtgctc
ggtactggcggcggcaatggagctgctgagcatgcccacttttcctcaccctcgtcgacc
gcatccaccctgtcgaatgcatcgccgctctgctcgcccctgaagcaccaccagcaacaa
caggagacgatgtccggcggcagcagcaaaatacccaaactgcccgacatcaatgcgcgc
agtgcgacgcccctgaacggtgtgcagcacggtgaagcgaagggaaagtccctctctacc
ccactgcttgcctcgatgccgaagctgccgctcagttcaccgagcaaatcgttggataac
ggcaacggctcgaccggctcggccgtgatcagtctggtgccgtacgatagcgatgatacc
agcagcaccagtgaggacgacgatgaggacgagaaggcgcacagtagagctacgatcgcc
ggcaaatcgctcgtgctcacgaacggtggcgccagtgcggcggtcaaacgtgccaagccg
cacagtagcgccccgtcgttgtttgcgaacggcaaacgcagtgctaaggaggagcaagac
gaagacgacggggacgatgacgacgaggaggaggaggaccaggatgacgaggagcggacc
agcacgtcttcctcccgctcgccacagatgatcaaaaccaaggcaggtctttggaaggtc
tccaagagcagtacggccgatcagctcagctacccggatagcggttccgcttcgtcctcc
aagtcttcctccccgacaacctcaggcgtttcctccccgactagctccccgggacagaag
cagcaaaaggtggttccgcaacgaaatggtgctgcttctgcgaacggtgcgggaagccgc
tcatcgtcgccgggcggtgaaggaaatgggtccagcaatggcaatggcaatcggaatggt
ggcgcttcggctgttcagatgctgatgaagtactcgcatcgaggatacggcgccccagtg
aagagctggaacggtcagcagacggcaatggaccgagagctggccaatgatcgacgggag
gaacgcaagcgccagattgaagacgatcgagaaacggaaatggatagaggacgcacgaag
aagaccaaggcaggtaccggcgggcccaataacaacaacaacaacaacaacagtggcaac
aacggcaacaacccgttccagcagtaccagaatcaccaaacgggcggtggcggcagcaat
ggcaaatggatgggtaacggtggcaaccgcaaccacttcaacaatcatcaccagaacaac
taccgcggtggtggtggcggtggtggctactaccagaatggaaatggccatcggcatcat
ggtggtggtggaaatagtgggtttcgtaccggtggcagacggttcggtggtcgcaatggt
ggcggattccactcaaaggctcatcatcaccatcagcgcagtgagtcgggtagcggcatg
gctggtggtggtggcggtagcaatgggttttatcatcgataa

DBGET integrated database retrieval system