KEGG   Anopheles gambiae (mosquito): AgaP_AGAP007600Help
Entry
AgaP_AGAP007600   CDS       T01036                                 

Definition
AGAP007600-PA
Orthology
K11852  
ubiquitin carboxyl-terminal hydrolase 31 [EC:3.1.2.15]
Organism
aga  Anopheles gambiae (mosquito)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2L
AA seq 1227 aa AA seqDB search
MEKHNTLDVATSARVAATGGSAGGASSKLKRAFSMPRNPFQGSRGSSNPPAKAVGNGNGT
AAAGEKDDESRCDSRLTNSNNQKKSTTTTASSGGGGGGEGTGATGNGNGSEKKIFRRLSV
KKFINRIAQQMTYVNRTVGNHKFDKVQSSQTSTLNGTVRGGGGAPAGEGGGGGGGGNFVW
PPDTVPGVIGLRNHGNTCFMNAVLQCLSHTDILAQYFVLDLYKADLKRRNKINAKKFGTK
GELTEQLALVLKSLWTCKDAPDYSSNFKAVVDRYGSQFRSSTQHDAQEFLFWLLDKVHED
LNTATKRKYKAIKNNGRSDEVIAAETLANYVRCNNSFVQAVFQAQFRSSLSCPTCGKQSN
TFDPFYCLSVPLPQLSQQPVLVKVIYSSQQPKQVKLGLGIPHGSPVLALREQLHADTGIA
LDRMILTEICESGFSRVFCDSHLMSSVRENDPLYCIECPPAGSGQEAASGTKIVLCLCNG
KRDFGGHVKRFGTPFCLVVHRDVSYSELQKLLLKEMSNILRSEVFTFATPAQSLFRMRLQ
DPSCDADTYLEATVEHPLFTEMIDLALSVLPTDAGPAHVKLLLEWTEPERFFNDMGDPFV
EHESVSQMREKIPASSALTLEQCFEHYTKAETLGQDNAWKCPHCQEYLPVVKTLGLWSLP
DIMVIHLKRFRQQQLRASTQAAKLTNLVKFPLHGFDMTPHLARDPSAHQQSSHPPWRKIM
RSAHSNQTHSMLAGAGGGGGTGRRQLAMDNRYDLYAVCYHQGDTLETGHYTAACKNPYDG
QWYRFDDQRVSHVPNDRIDEEIINNEAYLLFYQRRKLPSDGSGECSGSSSSSSGDHWVSK
IIVPPAPASAAATATLERNKKLQPVPTTAAAVKPLPVAVPTIEAVAPTAPTSSSAALTSS
AAETTASISPDSAPAKSPDRDSTQAKDSIVEVMSVSSANEKSRAEKLVTDTADVLSGRVV
APEAVEACSESNEMPKRDVVSNVTAIKSDQQSSLPSLSSSAVVPTEKQELIIATPEAKES
KKKGIDEAATKQSSETPNVNNATGSSAAAAPSPTSKVAAEEQSSRKDTLERFNQTSKSAD
DGGGESTKGKLPLRSDKHDRVEQKLGLATGSVPANGGGRFSLPSSQQFQDILWRENMSEL
MHHRPSSFTTYKSVIDAGDAVSLIRGANTCSKDTLLFIDQQNHGLVDRVVLDDDDDPDDL
LPPGSGSRALWISPVTPHKLITVSPKN
NT seq 3684 nt NT seq  +upstreamnt  +downstreamnt
atggagaaacataatacactggatgtcgcgacgtcggcccgggtcgccgccacgggtggc
agtgctggcggagcgagcagcaagttgaagcgagcattttcaatgccgcgcaatccattt
caaggttcgcgaggaagtagtaacccgcctgctaaagcggttggcaatggcaacggtact
gccgctgcgggcgagaaagatgacgaatcgcgctgcgattcgaggttaaccaacagcaac
aatcagaagaaatcgaccactacgacggcatccagtggtggtggtggtggtggggaaggc
accggagcaacgggcaatgggaacggcagtgagaagaagatcttccgccgattatcagtg
aaaaagtttatcaatcgcattgcacaacagatgacttatgtcaaccgtacggtgggcaat
cataaattcgacaaggtacaatcgtcccaaacgtccaccctcaatggcacggtacgaggg
ggaggtggcgcaccagcaggagaaggaggaggaggaggaggaggcgggaactttgtctgg
ccgccggacactgtgccgggtgtgatagggttgcggaaccacggcaacacttgcttcatg
aacgccgtcttgcagtgtctcagccacacggacatactggcacagtatttcgttttggat
ctttacaaggccgatctaaaacgacgcaacaaaattaatgccaaaaagttcggtacgaag
ggtgagctgacggaacagcttgctctggtgctaaaatcgctgtggacgtgcaaagacgcc
ccggactatagttcaaattttaaggctgtggtcgatcgatatggcagtcagttccgcagc
tctacccagcacgacgcacaggagtttcttttctggctgctggacaaggtgcacgaagat
ttgaacacggcaacgaagcgaaagtacaaagcgatcaagaataatggccgttccgatgag
gtgatcgcggccgaaacgctggccaactatgtgcgctgcaacaactcgttcgtgcaggcc
gtgttccaggcccagtttcgctcctcgctgtcctgcccgacctgcggcaagcagagcaac
acgttcgacccgttctactgtctgtcggtgccactgccccagctgtcccagcagcccgtg
ctggtgaaggtgatctactcctcgcagcaaccgaagcaggttaagctcggtttgggcatt
ccgcacggttcgcccgtgctggcgctgcgcgaacagctgcacgcggatacgggcattgcg
ctcgatcggatgatactgaccgaaatttgcgagtcgggtttcagtcgcgtgttctgcgac
tcgcatctcatgtcgtcggtgcgcgaaaacgatccactgtactgtatcgaatgtccgcct
gccggcagtgggcaggaggcggccagcgggaccaagattgtgctctgcctgtgcaacgga
aagcgggactttggtgggcatgtgaagcgcttcggtacgccgttctgtttggtggtgcac
cgagacgtatcgtacagtgagctgcagaagctgctgctaaaggagatgtcgaacattttg
cgatcggaagtgtttacgttcgctacgccggctcaaagcctgttccgcatgcgcctgcag
gacccatcctgcgatgcggacacctacctggaggccacggtcgagcatccactgtttacg
gagatgatcgatctggcgctgtcggtgctgccaacggatgcagggccggcccacgtcaag
ctgctgctcgagtggacggaaccggaacgattcttcaacgacatgggcgatccgttcgtc
gagcacgaaagcgtcagccagatgagggagaaaatcccggccagctcggccctaacgctc
gaacagtgcttcgaacattacaccaaggcggaaacgctcggccaggacaatgcctggaag
tgtccgcactgtcaggagtacctgccggtggtgaaaacgctcgggctctggtccctaccg
gacataatggtgatacatctgaagcgcttccggcagcagcaacttcgtgccagcacgcag
gcagcaaagctgacgaatttggtaaagtttccgctgcacggtttcgacatgacgccgcat
ctagcgcgcgatccctctgcgcaccagcaatcgtcgcaccctccgtggcgcaaaataatg
cggagtgcccattccaatcaaacacattccatgctggcaggagcaggcggaggcggcgga
accggccgtcgccagcttgcgatggacaaccggtacgacctgtacgccgtgtgctaccac
cagggcgacacgctggagacggggcactatacggcggcctgcaagaacccgtacgacggc
caatggtaccgcttcgacgaccagcgtgtctcacacgtgccgaacgatcgcatcgacgag
gaaatcatcaacaacgaggcttacctactgttctaccaaagacgaaagctaccgtcggac
gggtcgggcgagtgttccggcagctctagctccagttccggggatcattgggtctcgaaa
attattgtcccaccagcaccggccagcgccgcagcgacggcaacgttggaacggaacaag
aagctgcaaccagttccgacgacggcagcagcagtcaaaccgctgccagtggctgttccc
acaatcgaggcagtcgctccgacagctccaacctcgtcttctgcagctctgacctcgagc
gcggcagaaaccacggccagtatttcccccgattctgcaccggcaaaatcgcccgatcgt
gattccacacaagcaaaggatagcatcgtcgaggtgatgtcagtatcttcggcgaacgag
aaaagtcgcgccgaaaagctcgtcacagacacggcggacgtcttgtctggtcgtgtggtc
gccccagaagcggtggaagcttgtagcgaatcgaacgaaatgcccaaacgagatgtagtc
agcaacgtcactgcgataaaaagtgatcagcaatcttcattaccttcattatcatcgtca
gctgttgtgccaacggaaaagcaagaactcatcatcgcaacccccgaagccaaagaatca
aagaagaaaggtattgatgaagcagcgaccaaacaatcttcggaaacgccgaacgttaac
aatgccaccggtagtagcgccgccgctgccccgagccccactagcaaggtagcggcagag
gagcagtcgtcgagaaaggacacgctggaacggttcaaccaaacgtccaaatcggcggat
gatggtggtggtgagtcaacgaagggcaaacttccgcttcgcagcgacaagcacgaccgg
gtggagcagaagctcggtctggcaacgggatcggtacccgccaacggtggtggtcgcttt
tcgctcccttcctcgcagcaatttcaggacattctgtggcgggaaaacatgtccgagctg
atgcaccatcgaccgtcgtccttcaccacgtacaagagcgtgatcgatgcgggagacgcc
gtttcattgatccgtggtgcaaacacgtgcagcaaggacacgctgctgtttatcgaccag
cagaaccatgggctggtcgatcgtgtggtgctggacgacgatgacgatccagacgacttg
cttcccccgggtagcggaagtcgagcattgtggatttccccggttacgccacacaagctg
ataactgtgtcgccgaagaattaa

DBGET integrated database retrieval system