KEGG   Anopheles gambiae (mosquito): AgaP_AGAP007629Help
Entry
AgaP_AGAP007629   CDS       T01036                                 

Gene name
LANB2
Definition
AGAP007629-PB
Orthology
K05635  
laminin, gamma 1
Organism
aga  Anopheles gambiae (mosquito)
Pathway
ECM-receptor interaction
Brite
KEGG Orthology (KO) [BR:aga00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    AgaP_AGAP007629 (LANB2)
Cell adhesion molecules and their ligands [BR:aga04516]
 1. Immunoglobulin Superfamily
  Neural system
   Enzymatic CD
    PTPRF, LAR; receptor-type tyrosine-protein phosphatase F [KO:K05695]
     Laminin-1 Extracellular matrix (ECM) components
      AgaP_AGAP007629 (LANB2)
 2. Integrin Family
  Beta1 integrins
   VLA-1
    ITGB1; integrin beta 1 [KO:K05719]
      AgaP_AGAP007629 (LANB2)
     Laminin-2 Extracellular matrix (ECM) components
      AgaP_AGAP007629 (LANB2)
   VLA-2
     Laminin-1 Extracellular matrix (ECM) components
      AgaP_AGAP007629 (LANB2)
   VLA-3
      AgaP_AGAP007629 (LANB2)
     Laminin-10 Extracellular matrix (ECM) components
      AgaP_AGAP007629 (LANB2)
     Laminin-11 Extracellular matrix (ECM) components
      AgaP_AGAP007629 (LANB2)
   VLA-6
     Laminin-1 Extracellular matrix (ECM) components
      AgaP_AGAP007629 (LANB2)
     Laminin-8 Extracellular matrix (ECM) components
      AgaP_AGAP007629 (LANB2)
   VLA-7
     Laminin-1 Extracellular matrix (ECM) components
      AgaP_AGAP007629 (LANB2)
  Beta4 integrins
   alpha 6 beta 4
    ITGB4; integrin beta 4 [KO:K06525]
     Laminin-1 Extracellular matrix (ECM) components
      AgaP_AGAP007629 (LANB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2L
AA seq 1624 aa AA seqDB search
MTLRVRARLAALTAATVLLLLVLTTTSANENTHYLPPLECVDPYGRPQRCIPEFENAAYQ
LQVEATNTCGDETDTDFCVQTGYSNRKSCDVCHAGQHSPQFLTDFHDPNNPTWWQSETMF
EGVQYPNQVNLTLGLGKSFDITYIRIVFHSPRPESFAIYKRVTPNGPWIPYQYYSATCRD
TYGLPDSLSVMNGEDESRALCTSEYSDISPLRDGNIAFSSLEGRPSAINFDHHLELQQWV
TATDIRITLDRLNTFGDEVFGDAQVLKSYFYAIADIAVGARCKCNGHASECTTSTALDGQ
RTRVCKCMHFTDGPDCDRCLPFYNDAPWGRATSKNVHECKPCNCNGYSTKCFFDRHLYNL
TGHGGHCIDCGANRDGPNCERCKENFFMREDGYCINCGCDPVGSRSLQCNAEGRCQCKPG
VTGEKCDRCDSNYFNFGPHGCQPCNCDERGSLDNTPSCDPVTGVCSCKENVEGRHCRECR
LGYFNLDAENKFGCTPCFCYGHTLECTSASGYSIVSTTSNFNKHKEKWTAISDTGVPVDV
KYNSHSQSIGVGANGHRTVYFLAPDRFLGDQRASYNRLFKFRLQLVGQPRVEVSPYDVVL
QGGNSSISLPIFAQNQRMPSEESHEFAFRLHENPEYTWHPSNSGRGFMSILSNLTAVKIR
AIYGDYGEAILDDVELQTAHRGAAGRQATWIEQCTCPEGYLGQFCESCAPGYRHNPARGG
PFMPCVPCDCNKHAEICDSETGRCICQHNTAGDTCDQCAKGYYGNALGGTPYDCKRCPCP
NNGACMQMAGDTVICLECPVGYFGPRCELCSDGYYGDPTGVYGSVRMCQPCDCNGNVDPN
AVGNCNRTTGECLKCIHNTAGPHCDQCLPGHFGDPLAEPHGSCEECSCYPRGTEQTEKGI
SICDAINGNCHCKPNVIGRTCNECKNGYWNIVSGNGCESCNCDPIGSYNASCDTYSGDCF
CKPGVVGKKCDKCAPAYYGFSEDGCHACDCDPSGSKGSQCNQYGQCPCNDNVEGRRCDRC
KENKYDRHQGCLDCPACYNLVQDAANDHRAKLAELNQILQDIQSKPIVIDDSEFAGKLHA
VQEKIDILVEDAKSGSGGGEKTLNEILRELEARLQEVQKLLDNADQSQEVTNHKISKGGY
NATLANGKIQDARRQLDNAIELLQTEGNTALARAKDISGHLGNQTNQISGISREARQYAD
RFKAEADANMKQAQEAHKKASEALKKANDAFNQQANITKELDTSISSEIAQAREKLNTVS
KLTEQALTRAREVNDEALTLFAAVNRTAPPNIDIDKIKKEANQYNREADRIAEDLANKMR
DHAQLLENVGTNIELAETLLDRASLQKEDAVDALKQLKYAKEQAEKAVAEGDGTLQKANY
TYQTLAGFKNQVEESSRRAEEALNLVPNIERQIVNSRDLLQRAEEALYAASRNAEDARKN
AQTAQDKYAEEASKLAENIKKRANATKNTARDLHHEADQLNGRLAKTDNRLEEREAQIRK
DLNLTNEAKEKVGQAQLNSNEAKSQVDKAMREVSLIMSELANLREIDVNSLDDLERRLSA
AEKELEDAQLTKRLSSLVEAKNIQNQNIRSYQKELADLRLEVANIELIANSLPPGCFKRT
HLEP
NT seq 4875 nt NT seq  +upstreamnt  +downstreamnt
atgacgctaagagtgagagcccgtttggcggctctgacagcggcaacggtgttgctgctg
ctagtattaacgacgaccagtgctaatgagaacacacactatctgccaccgctggaatgt
gtcgatccttacggccgaccacagcgctgtattccggagtttgagaatgcggcctaccag
ctgcaggtggaagcgaccaacacgtgcggcgacgaaaccgatacggacttttgcgtccag
acgggctactccaaccggaagagctgtgacgtgtgccatgccgggcagcattcgccccaa
ttccttaccgacttccacgacccgaacaacccgacctggtggcagtcggaaaccatgttc
gagggcgtccagtacccgaaccaggtgaacctaacgctgggcctcggcaaatccttcgac
atcacgtacatccgcatcgtgttccactcgccgcggccggaatcgttcgcgatctacaag
cgcgtcacgccgaacgggccctggatcccgtaccagtactacagtgcgacctgccgcgac
acgtacggtctgcccgattcactgtccgtgatgaacggcgaggatgagtcgcgtgcgctc
tgcacgagcgagtacagtgacatctcgccgctgcgcgatggtaacattgcgttctcgtcg
ctcgagggacgcccgtccgccatcaacttcgatcaccatctggagctgcagcagtgggtg
acggcgaccgacattcggatcacgctggaccgtctgaacacgttcggcgacgaggtgttt
ggcgacgcgcaggtgctcaagtcgtacttctacgcgatcgcggatattgcggtcggggcg
cgctgcaagtgcaatggtcacgcaagcgaatgtaccaccagcaccgcactggacgggcag
cggacgcgcgtctgcaagtgtatgcacttcaccgacggaccggactgtgatcgctgtctg
ccgttctacaacgatgcaccgtggggccgtgcgacgtccaaaaatgtgcacgaatgcaaa
ccctgcaactgtaacggatactcgacgaaatgcttcttcgatcgccatctgtacaatctg
accgggcacggtggccactgcatcgactgtggtgcgaaccgggacgggccgaactgtgag
cggtgcaaggagaacttcttcatgcgcgaagacggctactgcatcaactgtggctgcgat
ccggtcggttcgcggtcgctgcagtgcaatgcggagggccgctgccagtgcaagccgggc
gtgacgggcgagaagtgtgaccggtgcgacagcaactacttcaactttggaccgcacggt
tgccagccgtgcaactgtgacgagcgcggctcgctcgacaacaccccgtcctgcgacccg
gtgacgggcgtgtgctcctgcaaggaaaatgtggagggccgccactgtcgcgagtgccgc
ctcgggtacttcaatctggacgcggagaacaagttcggctgcacaccgtgcttctgctac
gggcatacgctcgagtgcacgagtgccagcgggtactcgatcgtgtcgacgacatcgaac
ttcaacaagcacaaggaaaagtggaccgccatttcggacacgggcgtgccggtggacgtg
aagtacaactcgcacagccaatcgatcggcgtgggagcgaacggacatcggacggtgtac
ttcctggcgccggaccgcttcctgggcgatcagcgtgcctcgtacaacaggctgttcaag
ttccggctgcagctcgtggggcagccgcgcgttgaagttagcccgtacgatgtggtgctg
cagggtggcaacagtagcatctcgttgcccatcttcgcccagaaccagcgcatgccgagt
gaggaatcgcacgagtttgcgttccggctgcacgaaaatccggagtacacctggcatccg
tccaactcgggccgtggattcatgtcgattcttagcaatctgacggcggtcaagatccga
gcgatctacggtgactatggggaagccatactggatgacgttgaactgcagacggcgcac
cgtggtgcggctggacggcaggcaacgtggatcgagcagtgtacctgcccggaagggtat
ttgggacagttctgcgagtcgtgtgctcccggctatcggcacaatccggcccgtggtgga
ccgttcatgccgtgcgtaccgtgcgactgtaacaagcatgcggaaatttgtgactccgaa
acgggacgctgcatctgtcagcacaatacggccggcgatacgtgcgatcagtgcgcgaag
ggttactatggcaacgcgctcggaggcacgccgtacgactgtaagcgatgcccctgcccg
aacaatggtgcctgtatgcagatggcgggtgatacggtgatttgtctggagtgtccagtt
ggttactttggacctcgttgcgagctgtgctcggatggatactacggcgatccgaccggt
gtgtacggttcggtgcgaatgtgccaaccctgcgactgcaacggcaatgtggacccgaac
gctgtcggtaactgcaaccgcacgactggcgaatgtctcaagtgtatacacaacacggcc
ggaccgcactgtgaccagtgtttgccaggccactttggagacccactggcagagccgcat
ggaagctgcgaagagtgtagctgctatccgcgaggcacggagcaaacggagaagggcatc
tcgatctgtgacgccatcaacggcaactgtcactgcaaaccgaacgtgatcgggcgtacg
tgcaatgagtgcaagaacggctactggaacatcgtgtccggcaatgggtgcgaaagctgc
aactgcgacccgatcggtagctacaatgcgtcctgcgacacctactcgggcgattgcttc
tgcaagccgggcgtagtgggcaagaagtgcgacaagtgtgctccggcgtactacggcttc
tcggaggacggatgccatgcgtgcgattgtgatccgagcggctccaagggttcgcagtgt
aaccagtacggccagtgcccgtgtaacgataacgtcgagggacgacgatgcgatcgttgt
aaggagaacaagtacgatcgccaccagggctgtttggattgtccggcgtgttacaatctg
gtgcaggatgcggcaaacgatcatcgggctaagctggccgagctgaaccagatcctgcag
gacattcaatcgaaaccgattgtcatcgatgacagcgagtttgcgggcaaactgcacgca
gtgcaggagaagatcgacattctggtggaggacgcaaagagtggttcgggtggtggtgaa
aaaacgttgaacgaaattctgcgcgagctcgaggcccgtctgcaggaggttcagaagctg
ctggacaatgcggaccagtcgcaggaggtgacaaaccacaagatcagcaagggtggctac
aatgcaacgttggccaatggcaagattcaggacgctcgccgtcagctggacaatgcgatc
gagctgctgcaaacggagggtaatacggcgctggctcgcgcaaaggacatctcgggccat
ctgggcaatcagacgaaccagatcagtggtatttcccgtgaggcacgccagtacgcggac
cggttcaaggcggaagcggacgcgaacatgaagcaagcgcaggaagcgcacaagaaggca
tcggaagcgttgaagaaggcaaacgacgcgttcaatcagcaggccaacattaccaaggag
ctggacacgagcatatcgagcgagattgcacaggcgcgcgagaagctgaacacggtctcg
aagctgaccgagcaggcgctgacccgggcacgggaggtgaacgacgaagcgctgaccctg
ttcgcggcggtaaatcgtaccgcaccgcccaacatcgatatcgataagatcaagaaggag
gcgaaccagtacaaccgggaagcggaccgcattgctgaggatcttgccaataagatgcgc
gatcacgctcagctgctcgaaaacgtcggcaccaacattgagctggcggagacattactt
gatagagcttcgttacagaaggaagatgcagtcgatgcactgaagcagttgaagtacgcc
aaggagcaggcagaaaaggccgtcgcggagggagatggtacgctgcagaaggcaaactat
acctaccaaacgctggccggattcaagaaccaggtcgaggagtcttcaagacgtgccgag
gaagcgcttaatctagtgccgaacattgagcgacagatcgtcaactcacgggatcttctt
cagcgcgcagaagaggcactgtacgcagcgagccgaaacgcggaggatgcacgcaagaat
gcacaaacagcccaggacaagtacgctgaggaagcatcgaagcttgctgaaaacatcaag
aagcgtgccaatgctacgaagaacactgctcgcgatctacaccacgaagcggaccagctg
aacggacggctcgctaagacggacaaccgactggaggagcgcgaagcccagattcgcaag
gatctgaatctcacgaacgaggcaaaggaaaaggttggccaggcacagcttaactcgaat
gaggccaaatcgcaggtggacaaagcgatgcgagaagtcagcctgatcatgtccgagttg
gcgaatctgcgtgagatcgatgtcaacagtttggacgacttggaacgtcgtctgagtgct
gccgagaaggaactggaagatgcccagctgaccaagcggctcagcagtctggtggaagcg
aaaaacatccagaaccagaacatccgcagctatcagaaggagctggccgatctgcggctc
gaggtcgctaacatcgagctaatagcgaattcactgccaccgggatgctttaagcgcacg
catctggaaccgtaa

DBGET integrated database retrieval system