KEGG   Anopheles gambiae (mosquito): AgaP_AGAP007642Help
Entry
AgaP_AGAP007642   CDS       T01036                                 

Definition
(RefSeq) AGAP007642-PA
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
aga00010  Glycolysis / Gluconeogenesis
aga00030  Pentose phosphate pathway
aga00051  Fructose and mannose metabolism
aga00052  Galactose metabolism
aga01100  Metabolic pathways
aga01200  Carbon metabolism
aga01230  Biosynthesis of amino acids
aga03018  RNA degradation
Module
aga_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:aga00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AgaP_AGAP007642
   00030 Pentose phosphate pathway
    AgaP_AGAP007642
   00051 Fructose and mannose metabolism
    AgaP_AGAP007642
   00052 Galactose metabolism
    AgaP_AGAP007642
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    AgaP_AGAP007642
Enzymes [BR:aga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     AgaP_AGAP007642
Protein phosphatases and associated proteins [BR:aga01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     AgaP_AGAP007642
Messenger RNA biogenesis [BR:aga03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     AgaP_AGAP007642
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK PNPase_C
Motif
Other DBs
NCBI-GeneID: 1269584
NCBI-ProteinID: XP_564589
VectorBase: AGAP007642
UniProt: Q5TX32
Position
2L
AA seq 789 aa AA seqDB search
MSSAPVQRFIQFGAHKGKGIAVFTSGGDSQGMNAAVRAVVRMGIYVGCKVYFIREGYQGM
VDGGDNIVEANWSSVSSIIHRGGTVIGSARCKDFRERAGRLQAAHNLVSRGITNLVVIGG
DGSLTGANLFRQEWGSLLDELLASNRITQDQRIKYKSLHIAGMVGSIDNDFCGTDMTIGT
DSALHRIIEAIDAIVSTAYSHQRTFIMEVMGRHCGYLAVVAGVISEADYVFIPESPPPRD
WETKICDKLEQERSAGQRLNIIIVSEGAIDRDGNPITAEKVKQVVVDRLQQDTRITVLGH
VQRGGNPSAFDRVLGCRMGAEAVLALMEADDKTEPCVVSLDGNQAVRVPLMECVERTKAV
AKAMEDKNWELAVQLRGRSFARNLETYKMLTRLKPPKSAFDEQGRGVGGYTMAVMHIGAP
ACGMNAAVRSFVRNCIYRGDTVMGIHDGIEGLVAGHIKKMEWSDVTGWVGQGGAFLGTKR
TLPEGKFADIAARLKEFGIQALLIVGGFEAYHAAGQITDQRSKFKEFCIPIVVIPSTISN
NMPGTEFSLGADTGLNEITEICDRIRQSAQGTKRRVFVIETMGGYCGYLATLAGLAGGAD
AAYIYEEKFTIKDLQQDVYHMASKMSDGVQRGLILRNEKASENYNTEFIYRLYSEEGKGL
FSTRMNVLGHMQQGGSPTPFDRNMGTKMAAKCVEWLVEQLKANTQPDGSINATAPETACL
LGLVRRQYKFSPLKELIGETNFMQRIPKHQWWLKLRPLLRILAKHDSTYEEEGMYITVEE
EMSTDSPCA
NT seq 2370 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagcgcaccggtacaacggtttattcagttcggggcccacaagggcaagggcatc
gccgtcttcaccagcggcggtgactcccagggcatgaatgcggccgtccgtgcggtggta
cgcatgggtatctacgtcggatgcaaggtgtacttcatccgcgaaggctaccagggcatg
gtggacggtggtgacaacatcgtcgaggcaaactggtcgtcggtgtcgagcattatccat
cgcggtggtaccgtaatcggttccgcccgttgtaaggacttccgcgagcgggccggacgg
ctgcaggccgcccacaatctcgtgtcccgcggcatcaccaatctggtcgtgatcggtggt
gacggttcgctgaccggtgccaacctgttccggcaggagtggggcagcctgctggacgag
ctgctggccagcaatcggatcacgcaggaccagcgcatcaagtacaagagcctgcacatt
gccggcatggtcggttcgatcgataacgatttctgcggcacggacatgaccatcggtacg
gattcggcgctgcaccgtatcatcgaggcgatcgacgcgatcgtcagtacggcgtactcg
caccagcgtaccttcatcatggaggtaatgggtcgtcactgtggctatctagcggtcgtt
gccggcgtcatttctgaggccgactacgtcttcattcccgagtctccgccgccccgcgac
tgggagaccaaaatctgcgacaaactcgaacaggaacgttctgctggccagcgtctgaac
ataatcatcgtgtcggagggtgctatcgatcgcgatggtaatccgatcacggccgagaag
gtgaagcaggtggtcgtcgatcgtctgcagcaggacacgcgcatcaccgtgctgggtcac
gtgcagcgtggtggcaatccgagtgcgttcgatcgtgttttgggttgccgcatgggtgct
gaagcagtgctggcactgatggaagccgacgacaagacggaaccgtgcgtcgtatcgctc
gacggcaaccaggccgtccgggtgccgctgatggagtgtgtcgagcggacgaaagccgtc
gccaaagcgatggaggacaagaactgggagctggcggtgcagctgcgtggccgctcgttc
gcgcgcaatctcgagacgtacaagatgctgacgcgcctgaagccgccgaagagtgcgttc
gacgagcagggccgcggtgtcggtggctacacgatggccgtgatgcacatcggtgcaccg
gcctgcggcatgaacgcggccgtgcgttcgttcgtgcgcaactgcatctaccggggcgac
acggtgatgggcatccacgacggtatcgaggggttggtggcgggccacatcaagaagatg
gaatggtccgacgtgaccgggtgggtgggccagggcggtgcgttcctcggcacgaagcgc
acgctgccagagggcaagttcgcggatattgccgcccggctgaaggagttcggcatccag
gcgctgctgattgtgggcgggttcgaggcgtaccacgccgccggccagatcacggaccag
cgcagcaagttcaaggagttctgcatcccgatcgtcgtcattccgtccacgatctcgaac
aacatgcccggcacggagttttcgcttggcgccgacacggggctgaacgaaatcacggag
atttgcgatcgcatccgccagtcggcccagggtacgaagcgccgcgtgtttgtgatcgag
acgatgggcggctactgtggctatctggcaacgttggccggactggccggcggtgccgat
gcggcctacatctacgaggagaagttcacgatcaaggatctgcagcaggacgtgtaccat
atggcgtcgaagatgagcgacggcgtgcagcgcgggttgattctgcgcaacgaaaaggcg
tccgaaaactacaacaccgagttcatctaccggctgtactcggaggagggcaagggactg
ttctcgacgcgcatgaacgtgctcggccacatgcagcagggcggttcgcccaccccgttc
gatcgtaacatgggcaccaagatggcggccaagtgcgtcgagtggctggtggagcagctg
aaggccaacactcagccggacgggtcgatcaatgctaccgctcccgagacggcctgcctg
ctcggactggtgcgtcgtcagtacaaattctccccgctcaaggagctgattggtgagacc
aactttatgcaacgcatccccaagcatcagtggtggttgaagctgcgcccgctgctaaga
attctggccaaacacgactccacctatgaggaggagggcatgtacatcacggtcgaggaa
gaaatgtcgaccgactcgccgtgcgcttaa

DBGET integrated database retrieval system