KEGG   Anopheles gambiae (mosquito): AgaP_AGAP007690Help
Entry
AgaP_AGAP007690   CDS       T01036                                 

Definition
AGAP007690-PA
Orthology
K03350  
anaphase-promoting complex subunit 3
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Ubiquitin mediated proteolysis
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:aga04120]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
2L
AA seq 996 aa AA seqDB search
MIVQEPVQAAIWHCLNHYHYQDATFLAERLCAEVESEESIFLLATCYYRSGQKHLAHWLL
SKKSVRSTQCRFLLSKCAFDLKKYSEAENALINDDHLRQRHLDEIVKEFGDIACFALELV
SKICLKTERAKLANDASRRAVKLNPFLWQSFADLSSRGEKPDPDSVFQLTSTDIFQTSQA
HHYNSIVWFGGAGVHTSGPVLDPAAGGNDSSDQLGANIDNPSTPVDQCFTQNVNTPNNHH
PPGAPPGMGLGNAPYVPAQQNLNYSYINNSVGSIRVGGANLSAGDQTPTHVFTEHNTPFR
KQQFKYLTTISPTTPSFGVLPIIHTPNEPIAFLMTPSPQLVQGLIGDGTLGDPLAVAPNR
KIALLSSNKKMRRHHHNNLGTMGNIINRKHESPHHPQQAAIQLLQQQSTNTKPIVFSQTG
NQLTTTPRTPNTTGGALQQGQNVRRSSRLFSNSNSVKENAKSPQLNNKFVAPRSPPRRTK
QRISKTINSSVTTLMENIPEKKSSVCGAGGDAPVKEKIETITSTVDDSTSPLLNEKVLLN
NSINSAQKMAAQVLQLKKQSADGLMTLLRELGHGYLRLQNYECEKAIEHFSNVPLHHYES
SWVKSMIALAYHEMRDYESAVQIFHDIHEREPYRLQYMEIYSTDLWHLQKDVVLSSLAQD
LMAQDKTSPITWCVAGNCFSAHKEHETAIKFFFRAIQVDEEFAYSYALLGHELVMTEELD
KALSMYRLAVLHDPRHYNAWFGIGTVFCKQERHELAELHYRRALQINPRNSVIMVHIAVM
QFFLRKTDQAIRTLNAAIAIDPKNPQCKFQRGSMFFMMGRYHEALKELEELKQIVPKEAM
VYYLMGKIHKKLGNVDLALMHLSWATDLGSKGANNQIKDNFDSIIRTQDGDGSSSIDGSG
GGGSGGGAGESSRTGGDSTNGGAAGSGSAAHGDGGDVEDKIGSVVSLDPEAGSSSIDPDY
LLGFEHGSSDDSTAAVSMRNESLDIIANNFYDSDSY
NT seq 2991 nt NT seq  +upstreamnt  +downstreamnt
atgatcgttcaagaacctgtgcaggccgcaatatggcactgcctgaaccattaccactat
caagatgccacgtttcttgccgaaaggctctgcgctgaagtggagtctgaggagagtatt
ttcctgctggcaacatgttactatcgatcgggacaaaaacatttggcccattggttgctt
tcgaagaaaagcgttcgttccacgcagtgccgcttccttctttcaaaatgcgcctttgat
ttaaaaaaatactcggaagcggaaaacgccttgataaacgacgatcacctcaggcaaagg
catttggatgagattgtgaaggagtttggtgatattgcatgcttcgcgttggagctggtt
tcaaaaatatgcctaaagactgaacgagccaagctcgcgaacgatgccagtcggagagct
gtcaagctgaatcccttcctgtggcaatcgttcgcagatttaagtagccggggcgagaag
ccggaccccgatagcgtgtttcagctgactagcactgatatcttccaaacaagccaggca
catcactacaactccatcgtgtggtttggcggcgcgggtgtgcatactagcgggccagtg
ttggatccggcggcaggaggcaacgatagctcggatcaactaggcgccaacattgataat
ccgtcaacgccggttgatcagtgctttacgcaaaacgttaacacaccgaacaatcaccat
ccgccaggagcaccgccagggatggggcttggcaatgcaccgtacgttcccgcgcaacag
aacctgaactactcgtacattaacaattcggtcggatcgatacgcgttggcggggccaat
ctgagcgcgggcgatcagacgccaacacatgtattcacggaacacaatacaccattccga
aagcagcagtttaagtatctcaccacgataagccctacgacgcccagtttcggggtgcta
ccgatcatacacacacccaacgaaccgatagcgtttctcatgacaccttccccgcagctg
gtccaaggcttgataggggacggtacgttaggcgatccgctcgccgtggctcccaaccgg
aagatagcgctgttaagcagcaacaaaaagatgcgccgccatcaccacaacaatttgggc
acgatgggcaacatcatcaaccgcaagcacgagtcgccgcaccatcctcagcaagcagct
atacagctgctgcagcaacagagcaccaacaccaaaccgatcgtattcagccaaacagga
aaccaactgaccactacaccgcgcacacccaacacgaccggcggtgcgctacagcagggc
cagaatgtgcggcgcagctcgcgtctatttagcaacagcaactcagtcaaagagaacgcc
aaaagtccacaattgaacaacaaattcgtggcgccacggtcaccgccccggcgaacgaaa
cagcgcatttcgaagacaatcaacagcagcgtcacaacactgatggaaaacatcccggag
aagaagtcctcggtgtgcggtgctggtggtgatgcaccggtgaaggaaaagatcgaaacc
atcacatccacagtcgacgatagcacctcgccactgctaaacgagaaggtcttgctgaac
aacagcatcaacagcgcccagaagatggcagcgcaggtgctgcagctgaagaaacaaagc
gccgatgggctgatgacgcttctgcgcgagctagggcacgggtatctgcgattacaaaac
tacgaatgcgagaaagcgattgagcacttttccaacgttccattgcatcactacgagagt
agctgggtgaagagcatgatagcgctggcctaccacgaaatgcgcgactacgagtcggca
gtccagattttccacgacatccacgagcgcgaaccgtaccggctgcagtacatggaaatc
tacagcaccgatctgtggcatctgcaaaaggatgtagtgctgtcctcgctggcgcaggat
ctgatggcgcaggacaaaacctcaccgataacgtggtgcgtggcgggcaactgtttctcc
gcgcacaaggagcacgaaacggcgatcaagtttttcttccgtgcaatacaggttgacgaa
gagtttgcatacagctatgccctgctcggacacgagctggtcatgaccgaggagctggac
aaggcgctctcgatgtaccggttggctgtgctgcacgacccgcgccattacaatgcctgg
ttcggcattggtacagtattctgcaagcaggaacggcacgagctggccgagctgcactat
cgccgagcactgcagatcaatccgcgtaattcggtcatcatggtgcacatagccgtgatg
cagttcttcctgcgcaagaccgaccaggccatcaggacgctgaacgcggccatcgcaatc
gatccgaagaatccgcagtgcaagttccagcgcgggtcgatgttcttcatgatgggacgc
taccacgaagcgctcaaagagctggaagagctgaagcagatcgtgccaaaggaagcgatg
gtgtactatctgatgggcaaaattcacaaaaagctgggcaacgtcgatctggcactgatg
caccttagctgggccacggatctcggctcgaagggggcaaacaatcagatcaaggacaac
tttgactccatcattcggacgcaggatggtgacggtagcagcagcatcgatggtagtggc
ggcggcggcagcggcggtggcgccggcgaatcaagcaggacggggggcgactcgaccaac
ggtggtgccgcgggaagtggcagtgcggcgcacggtgacgggggcgacgtggaagacaaa
attggcagcgttgtcagcctggacccggaagcgggcagcagtagtatcgatccggactac
ttgctggggttcgagcatggctctagcgacgactcgactgccgcagtcagtatgcgaaat
gagtcactagacataatagcaaacaatttttacgatagtgacagctattag

DBGET integrated database retrieval system