KEGG   Anopheles gambiae (mosquito): AgaP_AGAP007690Help
Entry
AgaP_AGAP007690   CDS       T01036                                 

Definition
(RefSeq) AGAP007690-PA
  KO
K03350  anaphase-promoting complex subunit 3
Organism
aga  Anopheles gambiae (mosquito)
Pathway
aga04120  Ubiquitin mediated proteolysis
Brite
KEGG Orthology (KO) [BR:aga00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    AgaP_AGAP007690
Protein phosphatases and associated proteins [BR:aga01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     AgaP_AGAP007690
Ubiquitin system [BR:aga04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   APC/C
    Other subunits
     AgaP_AGAP007690
Chromosome and associated proteins [BR:aga03036]
 Eukaryotic Type
  Sister chromatid separation proteins
   APC/C complex
    AgaP_AGAP007690
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANAPC3 TPR_1 TPR_2 TPR_19 TPR_8 TPR_11 TPR_12 TPR_17 TPR_16 TPR_9 HrpB1_HrpK TPR_20 SRP_TPR_like
Motif
Other DBs
NCBI-GeneID: 1269539
NCBI-ProteinID: XP_308181
VectorBase: AGAP007690
UniProt: Q7QJW4
Position
2L
AA seq 996 aa AA seqDB search
MIVQEPVQAAIWHCLNHYHYQDATFLAERLCAEVESEESIFLLATCYYRSGQKHLAHWLL
SKKSVRSTQCRFLLSKCAFDLKKYSEAENALINDDHLRQRHLDEIVKEFGDIACFALELV
SKICLKTERAKLANDASRRAVKLNPFLWQSFADLSSRGEKPDPDSVFQLTSTDIFQTSQA
HHYNSIVWFGGAGVHTSGPVLDPAAGGNDSSDQLGANIDNPSTPVDQCFTQNVNTPNNHH
PPGAPPGMGLGNAPYVPAQQNLNYSYINNSVGSIRVGGANLSAGDQTPTHVFTEHNTPFR
KQQFKYLTTISPTTPSFGVLPIIHTPNEPIAFLMTPSPQLVQGLIGDGTLGDPLAVAPNR
KIALLSSNKKMRRHHHNNLGTMGNIINRKHESPHHPQQAAIQLLQQQSTNTKPIVFSQTG
NQLTTTPRTPNTTGGALQQGQNVRRSSRLFSNSNSVKENAKSPQLNNKFVAPRSPPRRTK
QRISKTINSSVTTLMENIPEKKSSVCGAGGDAPVKEKIETITSTVDDSTSPLLNEKVLLN
NSINSAQKMAAQVLQLKKQSADGLMTLLRELGHGYLRLQNYECEKAIEHFSNVPLHHYES
SWVKSMIALAYHEMRDYESAVQIFHDIHEREPYRLQYMEIYSTDLWHLQKDVVLSSLAQD
LMAQDKTSPITWCVAGNCFSAHKEHETAIKFFFRAIQVDEEFAYSYALLGHELVMTEELD
KALSMYRLAVLHDPRHYNAWFGIGTVFCKQERHELAELHYRRALQINPRNSVIMVHIAVM
QFFLRKTDQAIRTLNAAIAIDPKNPQCKFQRGSMFFMMGRYHEALKELEELKQIVPKEAM
VYYLMGKIHKKLGNVDLALMHLSWATDLGSKGANNQIKDNFDSIIRTQDGDGSSSIDGSG
GGGSGGGAGESSRTGGDSTNGGAAGSGSAAHGDGGDVEDKIGSVVSLDPEAGSSSIDPDY
LLGFEHGSSDDSTAAVSMRNESLDIIANNFYDSDSY
NT seq 2991 nt NT seq  +upstreamnt  +downstreamnt
atgatcgttcaagaacctgtgcaggccgcaatatggcactgcctgaaccattaccactat
caagatgccacgtttcttgccgaaaggctctgcgctgaagtggagtctgaggagagtatt
ttcctgctggcaacatgttactatcgatcgggacaaaaacatttggcccattggttgctt
tcgaagaaaagcgttcgttccacgcagtgccgcttccttctttcaaaatgcgcctttgat
ttaaaaaaatactcggaagcggaaaacgccttgataaacgacgatcacctcaggcaaagg
catttggatgagattgtgaaggagtttggtgatattgcatgcttcgcgttggagctggtt
tcaaaaatatgcctaaagactgaacgagccaagctcgcgaacgatgccagtcggagagct
gtcaagctgaatcccttcctgtggcaatcgttcgcagatttaagtagccggggcgagaag
ccggaccccgatagcgtgtttcagctgactagcactgatatcttccaaacaagccaggca
catcactacaactccatcgtgtggtttggcggcgcgggtgtgcatactagcgggccagtg
ttggatccggcggcaggaggcaacgatagctcggatcaactaggcgccaacattgataat
ccgtcaacgccggttgatcagtgctttacgcaaaacgttaacacaccgaacaatcaccat
ccgccaggagcaccgccagggatggggcttggcaatgcaccgtacgttcccgcgcaacag
aacctgaactactcgtacattaacaattcggtcggatcgatacgcgttggcggggccaat
ctgagcgcgggcgatcagacgccaacacatgtattcacggaacacaatacaccattccga
aagcagcagtttaagtatctcaccacgataagccctacgacgcccagtttcggggtgcta
ccgatcatacacacacccaacgaaccgatagcgtttctcatgacaccttccccgcagctg
gtccaaggcttgataggggacggtacgttaggcgatccgctcgccgtggctcccaaccgg
aagatagcgctgttaagcagcaacaaaaagatgcgccgccatcaccacaacaatttgggc
acgatgggcaacatcatcaaccgcaagcacgagtcgccgcaccatcctcagcaagcagct
atacagctgctgcagcaacagagcaccaacaccaaaccgatcgtattcagccaaacagga
aaccaactgaccactacaccgcgcacacccaacacgaccggcggtgcgctacagcagggc
cagaatgtgcggcgcagctcgcgtctatttagcaacagcaactcagtcaaagagaacgcc
aaaagtccacaattgaacaacaaattcgtggcgccacggtcaccgccccggcgaacgaaa
cagcgcatttcgaagacaatcaacagcagcgtcacaacactgatggaaaacatcccggag
aagaagtcctcggtgtgcggtgctggtggtgatgcaccggtgaaggaaaagatcgaaacc
atcacatccacagtcgacgatagcacctcgccactgctaaacgagaaggtcttgctgaac
aacagcatcaacagcgcccagaagatggcagcgcaggtgctgcagctgaagaaacaaagc
gccgatgggctgatgacgcttctgcgcgagctagggcacgggtatctgcgattacaaaac
tacgaatgcgagaaagcgattgagcacttttccaacgttccattgcatcactacgagagt
agctgggtgaagagcatgatagcgctggcctaccacgaaatgcgcgactacgagtcggca
gtccagattttccacgacatccacgagcgcgaaccgtaccggctgcagtacatggaaatc
tacagcaccgatctgtggcatctgcaaaaggatgtagtgctgtcctcgctggcgcaggat
ctgatggcgcaggacaaaacctcaccgataacgtggtgcgtggcgggcaactgtttctcc
gcgcacaaggagcacgaaacggcgatcaagtttttcttccgtgcaatacaggttgacgaa
gagtttgcatacagctatgccctgctcggacacgagctggtcatgaccgaggagctggac
aaggcgctctcgatgtaccggttggctgtgctgcacgacccgcgccattacaatgcctgg
ttcggcattggtacagtattctgcaagcaggaacggcacgagctggccgagctgcactat
cgccgagcactgcagatcaatccgcgtaattcggtcatcatggtgcacatagccgtgatg
cagttcttcctgcgcaagaccgaccaggccatcaggacgctgaacgcggccatcgcaatc
gatccgaagaatccgcagtgcaagttccagcgcgggtcgatgttcttcatgatgggacgc
taccacgaagcgctcaaagagctggaagagctgaagcagatcgtgccaaaggaagcgatg
gtgtactatctgatgggcaaaattcacaaaaagctgggcaacgtcgatctggcactgatg
caccttagctgggccacggatctcggctcgaagggggcaaacaatcagatcaaggacaac
tttgactccatcattcggacgcaggatggtgacggtagcagcagcatcgatggtagtggc
ggcggcggcagcggcggtggcgccggcgaatcaagcaggacggggggcgactcgaccaac
ggtggtgccgcgggaagtggcagtgcggcgcacggtgacgggggcgacgtggaagacaaa
attggcagcgttgtcagcctggacccggaagcgggcagcagtagtatcgatccggactac
ttgctggggttcgagcatggctctagcgacgactcgactgccgcagtcagtatgcgaaat
gagtcactagacataatagcaaacaatttttacgatagtgacagctattag

DBGET integrated database retrieval system