KEGG   Anopheles gambiae (mosquito): AgaP_AGAP007784Help
Entry
AgaP_AGAP007784   CDS       T01036                                 

Definition
AGAP007784-PA
Orthology
K07515  
enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Class
Metabolism; Overview; Carbon metabolism [PATH:aga01200]
Metabolism; Overview; Fatty acid metabolism [PATH:aga01212]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:aga00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:aga00650]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:aga00062]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:aga00071]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:aga01040]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:aga00280]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:aga00310]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:aga00380]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:aga00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3R
AA seq 771 aa AA seqDB search
MASVRLIGAAMQRNVTFGQALRLKALQSQMAMRYLATAAPAGKHMKTRIVDNVMVITLDS
PGVKVNSLNAEVQSEFDAVLREVETNPAVSSAVLISGKPGCFVAGADITMLEQCKTVEAA
TKVSHEGQIQFSKLEKSRKPVVAAINGVCLGGGLELALACHYRVALKDKKTVVGLPEVML
GLLPGAGGTQRLPKLTSIPTALDLALTGKSVKADKAKKLGIVDMLVNPLGPGLKPADQNT
LEYLEQVAIQVAKDLASEKLKVNRQKTGLVAKVTDFAFGIEWVKNKVFEKAREQVMKMSG
GLYPAPLKILDVIRVGVDKGQEAGYEAERKGFGELSQTPQSKGLIGLFRGQTECKKNRFG
KPANPPKTIGVLGAGLMGAGIVQVSIDKGYQVIMKDTTEAGLGRGIGQVQNGLQGAIKRK
RISAIERDQILSNLTSTLSYEPFRQTDIVIEAVFENIDIKHRVIKELEQVVPKHCIIATN
TSAIPITKIAAGSSRPENVVGMHYFSPVDKMQLLEIITHPGTSKETAAAAVEVGLRQGKV
VITVGDGPGFYTTRILSTMLSEAIRLLQEGVDPKDLDKMTKTFGFPVGAATLADEVGIDV
GAHIAVDLAKAFGDRFSGGNLGVMEDLVKAGFMGRKSGKGVFVYSGGRSKNREVNQDALA
IMKQKYALQSRGANSVEDMQLRMVSRFVNEAVLCLEEKILDSPLEGDVGAVFGLGFPPFT
GGPFRWVDQYGAERLVSKMRSYADLYGAPFVPAQTLLDMAKDSSKKFYPSK
NT seq 2316 nt NT seq  +upstreamnt  +downstreamnt
atggccagcgtaagactgatcggtgcggcaatgcagcgaaatgtgacctttggacaggcg
cttcgactgaaggcacttcaatcgcaaatggccatgcggtatctggccacggcagcgccg
gccggcaagcacatgaagacacgcatcgtggacaatgtgatggtgatcacgctggactcg
cccggtgtcaaagtgaactcgctaaatgccgaggtacagtccgagttcgatgccgtcctg
cgcgaggtggaaacaaacccggccgtcagctcggcggtgctgatctctggcaagccgggc
tgcttcgtggccggtgccgacattaccatgctcgagcagtgcaaaacggtcgaggcggca
acgaaggtgtcacacgagggccagattcagttcagcaagctggagaaatcccgcaaacct
gtggtggccgccatcaacggcgtttgcttgggtggagggctagagttggcccttgcctgt
cactaccgagtagcgcttaaggataagaaaacggtcgtaggattgcccgaagtgatgctg
ggtttgttgcccggagctggtggcactcagcgactgccaaaactgacctccatcccaacc
gcattggacctcgcccttaccggcaagtcggtaaaggccgacaaggcaaagaagctggga
atcgtggacatgctggtgaacccgcttggtcccggactgaagccagccgatcaaaacaca
ctcgagtacctggaacaagtggcgattcaagtcgcgaaggatcttgcctcggagaagctg
aaggtaaaccgccaaaagactggcttggtggccaaggtgacggactttgcgttcggcatc
gaatgggtcaagaacaaagtgttcgagaaggcacgcgaacaggtgatgaagatgtccggc
ggtctgtacccggctccgctcaagattctggacgtgatccgcgtcggtgtggacaagggc
caggaagccgggtacgaggcggagcgtaaaggatttggcgaactgtcgcaaacgccccag
tcgaagggtctgattggcctgttccgtggccaaaccgagtgcaaaaagaatcgcttcggc
aagccggcgaacccaccgaaaacgattggcgtgctgggagcgggtctgatgggtgccggt
atcgtgcaggtcagcatcgacaagggctatcaggtgataatgaaggacacgacggaggcg
ggactgggtcgcggtatcggccaggtccagaacggtctgcagggtgctatcaagcgcaag
cgcatcagtgcgatcgaacgcgatcagatcctgtcgaaccttacctccacgctgagctac
gaaccgttccgccagaccgatatcgtcattgaggccgtgttcgagaacatcgacattaag
caccgcgtcatcaaggagctggagcaggtggtgccgaagcactgcatcatcgccacgaac
acgtccgctattccgatcactaagatcgctgccggcagttctcgaccggagaacgtcgtt
ggcatgcactacttctcccccgttgacaagatgcaactgttggagattattacgcatccg
ggcacgtccaaggagacggcggctgctgccgtcgaggtgggcctgcgacagggcaaggtg
gtcatcaccgtgggtgacggacccggtttctacacgacccgcatcctctcgaccatgctg
tcagaggcaatcagactgctgcaggagggtgtcgatccgaaggatctcgacaagatgacc
aagacgttcggattcccggtcggtgcggccacgctcgcggacgaggtcggtatcgatgtg
ggagcgcacattgccgtcgatctggcgaaggcgttcggcgaccggttctccggtggcaat
ctgggcgttatggaggacctggttaaggccggcttcatgggacgcaagtcgggcaagggt
gtgttcgtgtactcgggcggtcgcagcaagaaccgcgaggtgaaccaggacgctctcgcc
atcatgaagcagaagtacgccctgcagtcgcgcggtgctaacagcgtggaggacatgcag
ctgcgcatggtttcgcgctttgtgaacgaagccgtcctctgtctggaggagaaaatcctg
gacagccccctggagggtgatgttggtgccgtgttcggtctgggcttcccgccattcacc
ggtggaccgttccgctgggtggaccagtacggtgcggaacggctcgtcagcaagatgcgc
tcgtacgccgatctgtacggtgctccgttcgtgccggcccaaaccctgctcgacatggcc
aaggactcgagcaagaagttttacccgagcaagtaa

DBGET integrated database retrieval system