KEGG   Anopheles gambiae (mosquito): AgaP_AGAP007873Help
Entry
AgaP_AGAP007873   CDS       T01036                                 

Definition
AGAP007873-PA
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
aga  Anopheles gambiae (mosquito)
Pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:aga00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    AgaP_AGAP007873
Protein kinases [BR:aga01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   AgaP_AGAP007873
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3R
AA seq 2477 aa AA seqDB search
MSMVKVLQFVNGLKSRNKDVQNKAIKDLSLYVKTELRETPDDMFFEDFNHHIFEMLTSTD
NNEKKGGILAIDCLINGDVVNTTNKISRYSNNLRNLLPMSDVCVMQLAANVLVKLALLPG
SNGASSFEFDIKRAFEWLSEDRVENKRHAAVLVLRELAVAMPTFFYQQVGSFFDHIFVAI
KDPKAAIREGAGQALRAVLIVTSQREGTKQNNNTQWHMNCYDQAFECLRDTVGREKNLNR
DDRVHGALIVFNEILRCSHAAWEKKYMQLDSLPVDQKRSLRSQREEEGRGFFPRIRVPFM
EKFGNHSGQSSVSYSSRYYDVVTDMKFFRQNSSVQESALYRALVKEKYDTICQAVLDQRS
SKSPYVIQTLLAIFPRLAAFNREEFVRLHLRTVANYLLTLLRSKEKERNAAFVSLGYIAV
AVEKEIEPYTKRIMELIGSALPLKDTPSKRKAPVDPSVFMCVMLLGHALKGGITHEIKEI
IAPMLSTGLSPALIVCLRELCETVPQAQQEITAGLLKILSYVLMNRPLPQFIVPKSHSVV
SPAFLSSLEQQPQSQPPQQQVHDTATIVLALQTLGKFSFEGCSLLQFVQRCADHFLNSEQ
QEIRIEAVHTCTFLLKLALQAAESNGNDVSETLTQTLSSVLEKILVVGITDVDPAVRLRV
LKSLDESFDTQLAQPWFLSSLLVTIHDEVFEIRELAIIIIGRLSTINPAYVMPSLRKTMV
QLLTELEHSGVSRNKEQSARMLDHLIVSTPRLVASYMRPILTILVPKLKEPDQNPSVVLN
VLRAIGDLAEVIGGHHVLQKWSDELLQLLLDMLSDAGSTEKRAVALWTFGQLVSATGQVV
VPYNKYPNLIDILINFLKTEQQLYVRRETIRVLGLLGALDPYKHKMNRGLIDSQTSANIL
ISVDTKTDEHTDLSTSEMLINMSTQLDEYYPAVVISTLMKILRDPTLSNHHLSVVQAITF
TFTSLGIKGVPYLSQVLPCLLRNIVTAEMSLKEYLFQQLSTLISIVKQHIIGFMDDIFEL
IKTSTASAASLQPTIINLVEKIAIALGCEFKVYLPQLMPQILRVLLHDTSKDRAVTVKLL
GAMRNFGNNLDDYLHLIIPAIVKLFEPLDIPLNVSITALQTINYLAEVLDFTDFSSRIVH
PLVRVLDFYPELRPVALTTLCSIMIQLGRKYLVFVPLVNRVMIKHKIPSVEYTKLLTKLQ
NNSTLAMDDEFRIRQARNRNREISLPSDSTIKKFPVSMSDLEAMFKANRRVSKDDWLEWL
RRLSIILLKESKNPALRSCATLAQNYPQLLKDLFNAAFVSCWSDLSEKLKQDLAHSLTQA
LTVQDLPEITQTVLNLAEFMEHCESYPLKIDSKILGERAMECRAYAKALHYKEDEFHRTD
DPPQSLFESLILINNKLQQKEAAEGLLEYAGRHRSSAEEMKVQVRWYEKLHSWEQARSLY
SEKLKSNPNDLESRLGEMRCLEALGEWSALNAVTTQNWDALGSEGQSKAGRLAAAAAWGL
QDWDGMHRFVRCIPEDTQDGAFYRAVLAVHNEQYALAQSLIDSTRDLLDTELTAMAGESY
ERAYGAMVCVQMLAELEEVIQYKLIPERRETIKSMWWDRLLGGQRLVEDWQRVIQVHSLV
LSPKEDIRTWLKFASLCRKNGSLKLSEKTLTMLLEYDPMENLSEPLPIDKPHVTFAYTKH
LHMAGYTKEAYDHLNRFVASFSPQAFTASSGAGGQDDLKDENRRLLARCFLKLGMWQSSS
TGGNLVKDHLINGILVCYSRATKHDPNWYKAWHNWAYMNFEVVQAKKQQEEYTKNPGSAA
ERNLIKHYAVPAVRGFFQSINLSQGNSLQDTLRLLTLWFDHAQYEEVYEALVEGMRVIDK
NTWLQVIPQLIARIDTPRNLVGQLINYLLTEIGKTHPQALVYPLTVASKSAPGTRKQAAH
KILNNMCEHSNTLVNQVLLISEELIRVAILWHEQWHEGLEEASRLYFGEQNVEGMFATLE
PLHAMLQRGPQTLKESSFNQAYGRDLTEAQEWCKHYKNSKNTRDLNQAWDLYYHVFRRIS
RQLVQLTSLELQYVSPKLLACRNLELAVPGSYTPGQQLICIASIETNLTIISSKQRPRKL
CIRGSNGKNYMFLLKGHEDLRQDERVMQLFGLVNTLLLNDRDTFRRNLTIQRYAVIPLST
NSGLIGWVPHCDTLHKLIRDYRDSKKTMLNIEHRIMLRMAPDYDHLTVMQKVEVFEHALD
QTKGDDLAKLLWLKSPSSEQWFDRRTNYIRSLAVMSMVGYILGLGDRHPSNLMLDRLSGK
ILHIDFGDCFEVAMTREKFPEKIPFRLTRMLINAMEVTGIEGTYRRTCESVMNVLRRNKD
SLMAVLEAFVYDPLLNWRLLDSDRLRRSKNAGDMDSVSGSMHEDSLLSYNARRDARLNEL
NATTGPAAGGQPSATNPVDVTNKKARAIVDRVKDKLTGKDFGKAEPVAVNRQIDLLIQQA
TSNENLCQCYIGWCPFW
NT seq 7434 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatggtaaaggtgctgcagttcgtgaacgggctcaagtcccgcaacaaggatgtg
cagaacaaggccatcaaggacctgtcgctgtacgtcaagacggagctgcgcgaaactccg
gacgacatgtttttcgaagactttaaccaccacatcttcgagatgctcaccagcacagac
aataacgagaaaaagggcggaatactggccatcgattgtctcatcaacggcgatgtcgtg
aacacgaccaacaagatttcccgctactcgaacaatctgcgaaatttgttgccgatgagc
gacgtttgtgtgatgcagctggccgccaacgtgttggtcaagctggcgctgctgcccggc
tcgaacggtgccagctcgttcgagttcgacatcaaacgtgccttcgagtggctgtcggag
gaccgggtcgagaacaagcggcacgccgcggtgctggtactgcgcgagctggccgtcgca
atgcccacgtttttctaccagcaggtcggaagcttcttcgatcacatatttgtcgcgatc
aaggacccgaaggcggccatccgggagggtgccgggcaggcgctgcgggccgtactgatc
gtgacgtcgcagcgcgaaggaaccaagcaaaacaataacacccagtggcacatgaactgc
tacgatcaggcattcgagtgcttgcgcgatacggtggggcgcgagaagaatttaaatcgc
gacgatcgcgtccacggtgcgctgatcgtgttcaacgaaatactgcgctgttcgcacgca
gcgtgggagaagaagtacatgcagctggacagtttgccggtggaccagaagcgatcgttg
cgttcgcagcgggaagaggaagggcggggattcttcccacgcatccgtgtgccttttatg
gagaagtttggaaaccattcgggacaaagctcggtcagctacagctcgcgctactacgac
gtcgtaacggatatgaagttcttccgccagaacagcagcgtgcaggagtcggcactgtac
cgagcgctggtgaaggagaagtacgacaccatctgccaggcggtgctggatcagcgtagc
tccaagtcaccgtacgttatccagacgctgttggcgatctttccgcggctggcagccttc
aatagggaggagtttgtgcggctgcatctgcgcacggtcgccaactacctgctgacgctg
ctacgaagcaaagagaaggaacgcaatgccgccttcgtatcgctcggctatattgcggtc
gcggtggaaaaggaaattgaaccgtacaccaaacgcatcatggagttgatcggaagtgca
ctgccgctgaaggatacacccagcaagcggaaagcgccggtggatccttccgtgttcatg
tgcgtcatgctgctggggcatgcgctgaaaggaggcataactcacgagatcaaggagata
atagcaccgatgctatcgaccggtctaagtccggcactgatcgtttgcttgcgggagctc
tgcgaaacggtgccccaggcgcaacaggagataacggcgggcctgctgaagatactgtcg
tacgtgctgatgaaccgacctttgccacaatttattgtgccaaagtcacactcggtcgtg
tcgccggcgttcttgagcagtctggagcagcagccacagtcgcaaccgccgcagcagcag
gtccacgatacagccacgatagtgctggcgctgcaaacgcttggcaagtttagcttcgaa
ggatgcagcttgctacagtttgtgcagcgctgtgccgatcactttctcaacagcgagcag
caggagatccgcatagaagcagtccatacctgtacgtttttgctaaagctagcgctccag
gcggcggaaagtaacgggaacgatgtgtcggaaacgcttacgcaaacgctcagctcggtg
ctggagaaaatcctcgtcgttggcatcacggacgtggatccggcggtgcgcttgcgagtg
ctgaaatcgctggacgaaagcttcgacacgcagctagcgcagccgtggtttctcagctcg
ctgctagtgacgatccacgacgaggtgtttgagatacgcgagctggcgatcatcatcatt
ggccggctgtcgacgatcaatccggcctatgtgatgccaagcttgcgcaaaacgatggtt
cagttgctgaccgagctggagcattcgggcgtcagccgcaacaaggagcaaagtgcgaga
atgctggatcatctgatcgtcagcacgccccggctggtggcgtcgtacatgcgcccgata
ctgaccattctcgtgccaaagctgaaggaaccggaccagaacccgagtgtggtgctgaac
gtgctccgtgcgatcggcgatctggcggaggtgattggcggccaccatgtgctgcagaag
tggtcggacgagctgctacagctgctgctggacatgctcagtgacgctggcagcacggaa
aagcgagctgtggcactgtggacctttgggcagctagtcagtgcgaccgggcaggtagtg
gtaccgtacaacaagtacccgaatctgatcgatatactgataaacttcctgaaaacggag
cagcaactgtacgtccgtcgggaaacgatccgagtgctgggtttgttgggagcgctcgac
ccgtacaagcacaagatgaatcgcgggctgatcgacagccagacgagtgcaaacattctt
atttctgtcgacacgaaaaccgacgaacatacggacctgtccacgtcggaaatgctgatc
aacatgagcacccagctggacgagtactatccggcggtggtcatatcgacgttgatgaaa
attttgcgcgatcccaccctgtccaaccatcatctcagcgtggtgcaggccatcacgttc
accttcaccagtctgggcatcaaaggggtcccgtacctctcgcaggtgttgccctgtctg
ctgcgcaacatcgtcacagccgagatgagccttaaggagtacctgtttcagcagctgtcc
acgctgatatcgatcgtgaagcagcacattatcgggttcatggacgacattttcgagctg
atcaagacctcgaccgcatcggccgcctcgctgcaaccgaccatcatcaatctggtggag
aagattgcgattgcgctcggttgcgagttcaaagtgtatctacctcagctgatgccgcaa
atattgcgcgtgctgctgcacgacacgtctaaggaccgggcggtgacggtgaagctactc
ggcgcgatgcgcaacttcggcaacaatttagacgactatctgcacctgattataccggcg
atcgtgaagctgttcgagccgctcgacataccactgaacgtttccattaccgcactgcaa
acgatcaactatctcgccgaggtgctagatttcactgatttttcttcgcgcatcgtgcac
ccgctggtgcgcgtgctcgatttctatcccgagctgcgtcccgtagcactcacgacgctc
tgctcgatcatgatccagctcggtcggaagtacctcgtgtttgtgccgcttgtgaatcgg
gtgatgatcaagcacaagatcccgtcggtggagtacacgaagctgctgacgaagctgcag
aacaacagcacactggcgatggatgacgagttccgcatacgacaggcccggaatcggaat
cgcgaaatttccctcccgagcgacagcacgatcaagaagttccccgtttcgatgtccgat
ctggaggcaatgtttaaggcgaatcgacgcgtctccaaggacgattggttggagtggctg
cgccggctgagcatcattctgctgaaggagtccaaaaatccggcccttcgatcgtgcgcc
acactggcccaaaactacccacagctactgaaagacctgttcaacgctgcgttcgtatcg
tgctggtcggatttgtcggaaaagctgaagcaggatcttgctcacagcctcacgcaggcg
ctgacggtgcaggatctgcccgaaattacccaaacggtgttgaatttggcggaatttatg
gagcactgcgaaagctacccgctgaagatcgactcgaagatactgggcgaacgagccatg
gagtgccgtgcttacgcgaaagcgctgcactacaaagaggacgaatttcaccggacagac
gatccgccccagtcgctgttcgagtcgctgatcctgatcaacaacaagctgcagcagaag
gaagcggcggaagggctgctggagtatgccggccgccatcggtccagcgccgaggagatg
aaggtgcaagtgcgctggtacgaaaagctgcacagctgggaacaggcgcggtcactgtac
tcggaaaagctgaagagcaatccgaacgatttggagtcccggctcggtgagatgcgctgc
ctggaagcgttgggcgagtggtcggcattgaatgctgtcaccacgcagaactgggatgct
ctcggctcggagggacagagcaaggctggtcggctggcagcagccgccgcctggggtctg
caggactgggatgggatgcatcggttcgtgcgctgcattccggaggacacgcaggacgga
gcattctatcgcgccgtgctggccgtacataatgagcaatacgcgttggcgcaaagtttg
atcgattcgacgcgtgatctgctggacacggagctgacagcgatggcgggcgagtcgtac
gagcgtgcgtacggtgcgatggtatgcgtgcagatgcttgccgagctggaggaagtgatc
cagtacaagctgatcccggaacggcgcgagacgatcaaatcgatgtggtgggaccgcctg
ctcggtggccagcggctggtcgaggactggcagcgcgtcatacaggtgcactcgctggtg
ctgtcgcccaaggaggacattcgtacgtggctgaagtttgcgtcgctctgtcgcaagaat
ggatccttgaagttgtccgagaagacactcaccatgctgctcgagtacgatccgatggag
aatctgagcgaaccgcttccaattgacaaaccgcacgtcaccttcgcctacacaaagcac
ctgcatatggcggggtacacgaaagaggcttacgaccacctgaaccggtttgtcgcgtcg
ttcagtccgcaggcgtttaccgccagcagtggtgcgggcgggcaggatgacttgaaggat
gaaaatagacgcctgttggcgcgatgcttcctgaagctgggcatgtggcagagtagttcc
accggcggaaacctggtaaaggaccacctcatcaatggcatcctggtgtgctacagccgg
gcaacgaagcacgatccgaactggtacaaagcgtggcacaactgggcgtacatgaacttt
gaagtggtgcaggcgaagaagcagcaggaagaatacaccaaaaatccgggaagcgcggcg
gagcgaaacttgataaagcattacgccgtgccggccgtccggggcttcttccagtcgatc
aacctctcgcagggcaattcgctgcaggacacactgcgcctgctaacgctctggttcgat
catgcccagtacgaggaggtgtacgaagcgctcgtcgaaggaatgcgtgtgatcgacaaa
aacacgtggctgcaggtgatcccgcagctgatcgcacgcatcgatacgccgcgcaatctt
gtcggccagctgatcaactatctgctgacggagatcggtaaaactcacccgcaagcgctc
gtgtatccgcttacggtggcctcgaagtcggcgccgggcacgcgtaagcaggcggcgcac
aaaatcctcaacaacatgtgcgaacattcgaacacgctggtcaatcaggtactgctgatc
agtgaggagctgattcgggtggccatcctttggcacgagcagtggcacgagggtttggag
gaagcgtcccggctgtactttggcgagcagaatgtggaaggcatgttcgcgacgctggaa
ccgttgcacgccatgctgcagcggggaccgcaaacgttaaaggaatcatccttcaaccag
gcgtacggacgtgacttgaccgaggcacaggaatggtgcaaacattataagaactctaaa
aatacgcgagatttgaatcaagcatgggacctatactaccacgtgttccggcgcatttcg
cgccagctcgtacagctcacctccctggagctgcagtatgtcagtccgaagctgctggca
tgtcgcaaccttgagctggcagtcccaggcagctacacgcccggtcaacagctgatctgc
atcgccagcatcgagacgaacctgacgatcatcagctcgaagcaacggcctaggaagctg
tgcatccgcgggtcgaatggtaaaaactacatgttcctgctgaaaggccacgaagatttg
cgccaagatgagcgagtgatgcagctgttcgggctggtcaacacactgctgctgaatgat
cgtgacacgttccggcgcaatctaaccattcaacggtatgcggtgatcccgctgagcacc
aactcgggtctgatcggttgggtgccccactgtgacacgctgcacaagctgatccgggac
tatcgcgattcgaagaaaacgatgctaaacatcgagcataggatcatgctgcgaatggca
ccggactacgaccatctcacggtgatgcagaaggtggaggtgtttgagcatgcgcttgat
caaacgaaaggagacgatctggcgaagctgctctggctgaaaagcccttcgtcggagcag
tggtttgatcggcgcacgaactacatccgctcccttgcggtcatgtcgatggtgggctac
atcttgggtctcggcgatcgccatccttccaatctgatgctggataggttgagtggaaaa
attcttcacatcgatttcggcgattgcttcgaggttgcaatgacgcgagaaaagttcccg
gagaaaatacccttccgcttgacgcgcatgctgatcaacgcgatggaggtgaccggcatc
gaaggaacgtatcggcgcacgtgcgagagcgtaatgaacgtgctgcgccgtaacaaggac
agtcttatggcggtactggaagcgttcgtgtacgatccgctgctcaactggcgcctgcta
gattcggaccgattgcgtcgttcaaagaacgccggtgacatggacagcgtgtcgggcagc
atgcacgaagactctctgctgagctacaatgccagacgcgatgctcggttgaatgagctg
aatgcaacgacgggaccggccgccggaggtcaaccgtcggctaccaatcccgtcgacgta
accaataagaaggcacgtgcaattgtcgatcgagtgaaggacaagctgaccggcaaagat
ttcggcaaagcagaaccagtggccgtcaatagacagatcgacctgctgatccagcaggca
accagcaacgaaaatctgtgccagtgctatatcggctggtgtccgttttggtaa

DBGET integrated database retrieval system