KEGG   Anopheles gambiae (mosquito): AgaP_AGAP007920Help
Entry
AgaP_AGAP007920   CDS       T01036                                 

Definition
(RefSeq) AGAP007920-PA
  KO
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aga00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AgaP_AGAP007920
   00053 Ascorbate and aldarate metabolism
    AgaP_AGAP007920
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    AgaP_AGAP007920
   00860 Porphyrin and chlorophyll metabolism
    AgaP_AGAP007920
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    AgaP_AGAP007920
   00982 Drug metabolism - cytochrome P450
    AgaP_AGAP007920
   00983 Drug metabolism - other enzymes
    AgaP_AGAP007920
Enzymes [BR:aga01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     AgaP_AGAP007920
Glycosyltransferases [BR:aga01003]
 Others
  Hydrophobic molecule
   AgaP_AGAP007920
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3R
AA seq 1023 aa AA seqDB search
EQTAACTMLRTVILVALALSQGTEAYKVLGLFPHPGQSHFHFFQPVLKGLAEAGHEVTVV
SHFPEKNPPANYHDLPLAGMTSLSDSVSFELFEYRPGFGHFMEFFMLYTWGKEACANALN
STAIQTVLDSKVQYDLILVEQFNSDCMLGIAHQLKAPYIGLSSCPLMPWHYERVGNPTLP
AYIPALFMGYTERMDFSQRLANWITVQSFKALYSWFNDAAANKLLGERFGQGAIPDVREL
QQRTAMMFVNQHYSLSGAKPLSPAVLEIGGIHIRDFRPLEADLQQLLDTADHGVIYISWG
SMIRAETLPAEKRDAILKALGRFKQRVIWKWENETLPNQPSNVHIRKWLPQREILCHPKV
RVFMSHGGLLGSSEAAYCGVPVVATPMYGDQYNNAAALANRGMGVVLAYEDITADSVYDA
LRKVLEPEAMEHAKQVSFSYRNRPQSPLESAVWWCEHVAATGGLPLAQSYSSELPWYSYH
QFDVYIVTITFLILLIVLAIGSSSHGYRILGLFPHPGLSHFKVFHPIMRGLANDGHHVTV
LSYFPDSDPVPNYHDLRFEGQEVLTNTFSLQDFTGRTFIDNFHEFHELVVWGMDSCKAAL
DSPAIDQILEAHRVAPFDLVVMEVFATDCMAGISWLLQVPLVGLSSCAIMPWHYDRVGLP
DTPSYIPSEFSTFSEEMSFWQRFENWLVTRVVKHLYRIVQISDNRLLKEKFPNAAIPDVA
EIVQNTSLILINQHYTLSGARPLVPAVVEIGGVHIQGEKPLPTKLQQIMDQSSNGVIVVS
FGSVLKAATLPTAKRNAMLEAFERFDQQVVWKWEDELDNPPKNLYTQKWLPQRDVLCHKN
VRLFVSHGGLLGVSEAVHCGVPVVVMPIYGDQFLNAAALVNRGAGVRMDYELVDNVTYIA
SCIGEGLSDRKRRMAQSLSRAYKTRPQIPLDLARWSIINVIENGAMEYERSYAPKLPWYI
YYSLDVILVLLFAALTLVFGERLDPVAGFSVDSANHTHCTEGQNHADTPPKCTRKTRANR
SYF
NT seq 3072 nt NT seq  +upstreamnt  +downstreamnt
gagcagacggcggcttgcacaatgctgcgaaccgtgatactggtggcccttgccttgtcg
caaggtaccgaggcgtacaaagtgctcggactgttcccgcatcccggccagagtcacttc
cacttctttcagcccgtcctgaaagggctggcagaggccggccatgaggtaacggtcgtc
agccacttcccggagaagaatccaccggcgaactatcacgatctgccgctcgccggcatg
acatcgctgtcggattcggtcagctttgagctgtttgagtatcggcccggctttggacat
ttcatggagttcttcatgctgtacacctggggcaaggaggcgtgcgccaacgcgctcaac
tcgaccgccatccagaccgtgctcgactccaaggtgcagtacgatctgatcctggtcgag
cagttcaacagcgactgcatgctcggcatagcgcaccagctaaaagcaccgtacatcggg
ctcagcagctgcccgctgatgccgtggcactacgagcgcgtcggcaacccaacgctgccc
gcgtacatcccagccctcttcatgggctacaccgagcggatggacttctcgcagcgactg
gccaactggattacggtgcaatcgttcaaggccctgtacagctggttcaacgatgccgcc
gccaacaagctgctgggcgaacggttcggccagggcgcaataccggacgtgcgcgaattg
cagcagcgcaccgcgatgatgttcgtcaatcagcactactcgctgagtggcgccaagccg
ctcagcccggccgtgctcgagatcggaggcattcacatccgcgactttcgcccactggag
gccgatctgcagcagctgctcgatacggccgaccatggcgtgatctacattagctgggga
tcgatgataagggcggaaacgctgccggcggaaaagcgcgatgccatcctgaaggcgctc
ggccggttcaagcagcgcgtcatctggaagtgggaaaacgaaacgctaccgaaccagccg
tccaacgtccacatccggaagtggttgccgcagcgagagattctctgtcatcccaaggtt
cgcgtgtttatgagccacggtggactgctaggatcatccgaagccgcctactgtggtgta
ccagtcgttgctacgccaatgtacggtgatcagtacaacaatgcagctgcactggctaat
cggggcatgggtgtggtactggcctacgaagacatcacggccgactcggtctacgatgcg
ctgcgcaaggtgctcgaaccggaagcgatggaacacgcgaagcaggtctcgttctcgtac
cgcaaccgtccgcaaagtccgctcgagtcggccgtctggtggtgtgagcatgtggccgct
accggtggcctaccgctggcacagtcgtactccagcgagctgccctggtactcgtaccat
cagttcgatgtgtacatcgtgacgatcaccttcctcattctgcttattgtgctggcaatc
ggttcttcaagccatgggtaccggattttgggactgtttccccatccaggattaagccat
ttcaaagtgtttcatcccatcatgaggggcctggcgaacgatggtcatcatgtaacggtg
cttagctattttccagattcggaccccgtaccaaattatcatgaccttcgcttcgaaggg
caggaggttttgacgaatacgttcagcttacaggattttactggcagaacttttatcgat
aattttcacgaattccacgaactagttgtgtggggcatggacagttgcaaggcggcgctg
gattcgcctgccatcgatcaaatactcgaagcgcatcgagtggccccattcgatttggtc
gtgatggaagtgttcgctaccgattgtatggcgggcatatcctggctgttgcaagttcct
ttagtgggtttgagcagctgtgcgataatgccttggcactacgatcgtgtcggattgccc
gatactccctcgtacattccatcggagtttagtacattttcggaagagatgagcttctgg
caaaggtttgaaaattggttagtaaccagagtggtaaagcatttgtatcgcattgtacag
attagtgacaacaggctgttgaaggaaaagttcccgaatgcagccattcccgacgtggct
gagatcgtgcagaatacctcgctgatactgataaatcaacactacaccctcagcggtgct
cggccgttagttcctgcggtggtagagatcggtggagtacacattcaaggcgagaaacct
ttgccaacgaaattgcaacagattatggaccaatcatccaatggggtgatagttgtgtcc
tttggatccgtgctaaaggctgctacacttccaacggcaaagcgaaacgctatgctggaa
gcattcgaacgtttcgatcagcaagtggtgtggaagtgggaggatgaactcgacaatccg
cccaaaaatctctacacacagaaatggcttcctcagcgggatgtgttgtgccataagaat
gtacggctttttgtgtcgcacggaggattgctgggtgtttctgaagctgtccactgtggt
gtgccggtcgttgttatgcccatttacggcgatcagtttctcaacgcggcagccttggtc
aatcgtggagctggagttcgtatggattacgagctggtggacaatgtaacttacattgct
agctgcatcggcgaaggtttaagcgacagaaaacgacggatggctcaatccttgtcacgt
gcttacaaaacacgaccacaaataccgctggatttggctcggtggtcaattatcaatgta
atcgagaatggtgctatggagtacgaacgttcgtacgcaccgaaattgccttggtatatc
tattactcgttggatgtaattttggtacttttgtttgccgcattaacattagtttttgga
gaacgactggatcccgtcgcgggcttttcggtggattcggcaaaccatacacattgcaca
gaaggtcaaaatcacgccgatacgccaccgaaatgcactcgtaaaactcgcgcgaaccga
tcgtatttttga

DBGET integrated database retrieval system