KEGG   Anopheles gambiae (mosquito): AgaP_AGAP007957Help
Entry
AgaP_AGAP007957   CDS       T01036                                 

Definition
AGAP007957-PA
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:aga00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    AgaP_AGAP007957
Enzymes [BR:aga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     AgaP_AGAP007957
    2.7.1.82  ethanolamine kinase
     AgaP_AGAP007957
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3R
AA seq 510 aa AA seqDB search
MRDIAARICRDYLTGAWKTISADELQLKRISGGLSNFLYYVSLPEHHYYGNNNNNNNNGG
KKSHPNSRRGSLLEPKEVLLRIYGQTHGEHALETMLTESVVFTLLSERKLGPKLHGIFPG
GRIEQYIPARALLTAELSDAKISLKVAEKMAAIHSMDIPVSKEPDWIWNTMARWLKGIAG
TLETMERDRANGNVKKAGGIGDQSGEEASIITTMDLAGEVEWLRSVIESEDFPVVFCHND
LQEGNILLRQDYPTVSEPSFRECTTLDNFDESAQLDSHFSSILISNGGVVSSNESVSPSD
GNIGLNRSSRTLPIPFHFRKRSLDHDSMENDLDNTRDSVLSGNSQALSDANSSTDGEPEL
MIIDFEYCAYNYRGFDLANHFLEWTFDYTNTQSPYFYHKLDQYPTAEQQEKFITQYLSHL
SPPMEDGLEIGDQVEQVRREVQCFTMASHLFWSLWAIVNVYQEIEFGYMEYAVCRLKQYQ
QAKQCYIETTMPNGGNGCPGEQTPPVDPEK
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atgcgggacattgcggctcgtatctgtcgggactatctgaccggtgcctggaagacgata
tcggccgacgagctgcagctgaagcgcatcagcggtggactctccaacttcctctactac
gtcagcctgccggagcatcattattacggcaacaacaacaacaacaacaacaatggtggc
aagaaatcgcatccaaactcacggcgaggctctttgctagaaccgaaggaggtgctgcta
agaatttacggtcaaacgcacggggaacatgcgctggaaacgatgcttaccgaatcggtc
gtgtttacgctgctgagcgagcgcaagcttggcccgaaactgcacggcatctttccgggc
ggccgcatcgaacagtacataccggcccgggccctgctgacggcggagctgagcgatgca
aagatatcgctaaaggtagcggaaaagatggccgccatccacagtatggacataccggtg
tcgaaggaaccggactggatctggaacacgatggcccggtggctgaagggtatcgccgga
acgctggaaacgatggagcgcgatcgggcgaacggcaacgtgaagaaggccggtggtatc
ggggatcagtcgggggaagaagcaagcatcattaccacgatggatctggcgggtgaggtc
gagtggttgcgatcggtaattgagagcgaagactttccggtcgtcttttgtcacaacgat
ttgcaggagggcaacatactgctgcgacaggattatcccacagtgagcgaacctagcttc
cgcgaatgcacaactttggacaatttcgatgaatcggctcagctcgattcacacttcagc
agcatcctaatatcgaacggcggtgtggtttctagcaatgaatcggtatctccatccgat
ggtaacattggtctcaatcgaagctcgagaactttgcctattcctttccatttcagaaag
cgatcgctggatcacgattcaatggagaacgatctggacaatacgcgcgattcggtgctg
agcggcaactcccaagccctgtcggacgcaaactcttccacggacggcgagccggaactg
atgatcattgacttcgagtactgtgcctacaactatcgcgggttcgatctggccaaccac
ttcctcgagtggacgttcgactacaccaacacgcagtcgccctacttctaccacaagctg
gaccagtaccctaccgccgaacagcaggaaaagttcatcacgcagtacctgagccacttg
tcgccaccgatggaggatgggctggagattggcgaccaggtcgagcaggtgcgccgggaa
gtgcagtgcttcaccatggcgtcccatctgttctggagcctgtgggccatcgtgaacgtg
tatcaagagatcgagtttggctacatggagtacgccgtttgccgactaaagcagtaccaa
caggccaaacagtgctacatcgaaacgacaatgcccaacggcgggaacggttgtccgggc
gagcagacaccaccggtcgatccggagaaatga

DBGET integrated database retrieval system