KEGG   Anopheles gambiae (mosquito): AgaP_AGAP007975Help
Entry
AgaP_AGAP007975   CDS       T01036                                 

Definition
AGAP007975-PA
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:aga00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    AgaP_AGAP007975
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AgaP_AGAP007975
   00020 Citrate cycle (TCA cycle)
    AgaP_AGAP007975
   00620 Pyruvate metabolism
    AgaP_AGAP007975
Enzymes [BR:aga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AgaP_AGAP007975
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3R
AA seq 512 aa AA seqDB search
MLRTIIVRNENLLLQGSVRKILKGTAVRSLSSECAKRSAAGHRSSHNNLSNGRSSLKEVT
WRTNFVRGYCSGFPAHSKVLLPALSPTMELGTIVSWEKKEGDKLNEGDLLAEIETDKATM
GFETPEEGYLAKILVPAGQKDVPIGKLVCIIVENEADVAAFKDYKDTGGAAKPAAAAAPA
PPPPAAAPPTPTPPPVAAAPPPPPMAAAPQPMTAVEQRGPRVYASPMAKKLAEQQRLRLE
GKGSGLFGSLTSKDLAGMQAAGAAPSAGGAPATAASIPAGAAYVDLPVSNIRGVIAKRLL
ESKTTIPHYYLTVDVNMDQVTKLRARFNKQLEKEGVKLSINDFVIKAAAMACKKVPEANS
AWMDTVIRQFDAVDVSVAVSTDRGLITPIVFSADRKGIADISKDVKNLAAKARDGKLQPQ
EFQGGTFSVSNLGMFGVTHFCAIINPPQSCILAVGGTQKRLVPDKDSEKGFKESDYVSVT
LSCDHRTVDGAVGARWLQYFRQFLEDPNSMLL
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgttacgaacaatcatcgtacgaaacgagaatctcctgctgcaaggatcggtccgcaaa
atactgaaaggaactgctgttcgctcgctcagcagtgagtgcgccaaacgatcagccgcc
ggccaccgcagctcgcacaacaacttatcgaacggtcgcagcagcctgaaggaggtgaca
tggagaacgaactttgtccgcggatattgcagcggctttccggcccactcgaaggtcctg
ctgccggccctgtcgcccacgatggagctcggaactatcgtcagctgggagaagaaggag
ggcgacaagctgaatgaaggtgatttgctggcggaaatcgaaaccgacaaagcgaccatg
ggcttcgagacgcccgaggaaggctacctggcgaagatcctggttccggccggccagaag
gatgtccccatcggcaagctggtgtgcattatcgttgaaaatgaggccgacgtggcagcg
ttcaaggattacaaggatacgggcggtgcggccaaaccggctgctgcggctgctcccgca
ccaccaccaccggccgccgccccaccaacaccaacgccaccgccagtcgctgccgcaccc
ccaccgccaccaatggcggccgcccctcaacccatgactgcggtggagcagcgtggaccc
cgtgtctatgccagcccgatggcgaagaagcttgccgagcagcagcgtttgcgattggaa
ggcaaaggatccggcttgtttggttcactaacgtctaaggatcttgcaggtatgcaagcg
gccggtgctgccccatcggccggcggtgcgcctgctaccgccgcttccatccctgccggt
gcggcgtacgtcgacctgccggtatcgaacatccgtggtgtgattgcgaagcgattgctc
gagtcgaagaccaccatcccgcactactacctgacggtggacgtcaacatggatcaggtg
acgaagctgcgggcccgcttcaacaagcagctcgagaaggagggcgtcaagctgtcgatc
aacgatttcgtcatcaaggcggcggcaatggcctgcaaaaaggtgccggaagcgaactcc
gcctggatggacacggtgatccgtcagttcgacgcggtcgatgtgtcggtggccgtgtcg
accgaccggggactgattacgccgattgtgttctcggccgaccggaagggcattgccgac
atcagcaaggatgtgaagaatctggcggcgaaggcgcgcgacggcaagctgcagccgcag
gagttccagggcggcacgttcagcgtgtcgaacctgggcatgttcggggtgacccatttc
tgcgccatcatcaatccgccccagtcgtgcattctggccgtcggtggcacccagaaacgt
ctcgtacctgacaaggactcagagaagggcttcaaggaaagtgactacgtgtcggtaacg
ctcagctgtgaccatcgtacggttgatggtgctgtcggtgcccgctggttgcagtacttc
cgccagttcctggaagaccccaactcgatgttgctgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system