KEGG   Anopheles gambiae (mosquito): AgaP_AGAP008039Help
Entry
AgaP_AGAP008039   CDS       T01036                                 

Definition
AGAP008039-PA
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Wnt signaling pathway
Hedgehog signaling pathway
Module
cAMP signaling
Brite
KEGG Orthology (KO) [BR:aga00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    AgaP_AGAP008039
   04340 Hedgehog signaling pathway
    AgaP_AGAP008039
Enzymes [BR:aga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     AgaP_AGAP008039
Protein kinases [BR:aga01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   AgaP_AGAP008039
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3R
AA seq 368 aa AA seqDB search
KDRMKQESSHKFSAGSDYHQTLSRLKTEFEKRYNDQKQASIASLTEYEILRTLGSGAFGT
VKLIKRKASGEYFAMKILSKERIVYQKQLQHTTNEKRILQSIRFPFVVNLEICYKDNSYL
YLVMPFVNGGEMFTLLRHSRRFSEAQAAFYGAQVALALEYLHGCNLIYRDLKPENLLVDY
RGYVKMTDFGFCGKKMYLSIILGLVNANSNPSIAIKLIKDRTWTLCGTPEYLAPEIIQAK
GYGKSVDWWSYGVLLYEMAAGYSPFYVNSSDQMVLFERICKGKYKFPKSFSTDLCSLVHH
LLQTDLSRRYGNLRNGCDDIKQHAWFKTINWYGLLNRELPAPYVPKLQGPGDASLFDVYD
EQKLKIAS
NT seq 1106 nt NT seq  +upstreamnt  +downstreamnt
aaggacagaatgaagcaagaaagttcacataaattctcagccggcagtgattaccatcaa
actttaagccggttgaaaacagaatttgaaaaacggtacaatgaccagaaacaggcatcg
attgcctcgctcacggagtacgagatactacgcactcttgggtccggagcgttcggaact
gtgaaactgatcaaaagaaaagcgagcggagaatactttgccatgaagatactgtccaag
gaaaggatcgtctaccagaagcagctacagcacacgacgaatgagaaacgaattctgcaa
agcattcgcttcccgttcgtggtaaatctggaaatctgctacaaggacaactcctacctc
tacctcgtgatgccgttcgtgaacgggggcgaaatgttcacactgctacgccattctcga
cgattttccgaagcacaggctgccttctacggtgcccaggtggcgctggcgctcgagtat
ttgcatggttgcaatcttatctatcgggatttgaaaccggaaaatcttctcgttgactac
cggggatatgtgaaaatgaccgattttggtttttgcaaggtaagaaaatgtatcttagca
tcatcctaggattagtaaatgctaattctaacccatcaatcgcaatcaagttgatcaaag
accggacctggacgctctgcggcacaccggaatacctcgcaccggaaatcatccaggcga
agggctacgggaaaagtgtcgactggtggtcttacggtgtgctgctgtacgaaatggccg
ccggatactctcccttctacgtgaacagttccgaccagatggtgctgttcgagcgcattt
gcaaaggcaagtacaagttcccgaagagcttctccaccgatctgtgcagtctggtgcacc
atctgctgcagacggatctctcccggcgctacggcaatctgcgcaatgggtgcgacgaca
tcaagcagcacgcctggttcaagacgatcaactggtacggcttgctgaaccgggagcttc
ccgcaccgtacgtccccaagcttcaggggccgggcgatgcctcactgttcgatgtgtacg
atgagcaaaagctcaagatcgcctcc

DBGET integrated database retrieval system