KEGG   Anopheles gambiae (mosquito): AgaP_AGAP008043Help
Entry
AgaP_AGAP008043   CDS       T01036                                 

Definition
AGAP008043-PA
Orthology
K16174  
small subunit ribosomal protein S18b, mitochondrial
Organism
aga  Anopheles gambiae (mosquito)
Brite
Ribosome [BR:aga03011]
 Ribosomal Proteins
  Mitochondria
   Small subunit
    AgaP_AGAP008043
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3R
AA seq 220 aa AA seqDB search
MSVLRLIGGEIISIYRQSLLTIGTSQARALTTTGFLRHAAKPESEATEEAAASEEPEAGE
ADANGAPKQPVDDPKDRTRVIPVETSIRYLASEAYRQTYQDDPVWKQYRRNHKGPYPPKL
TRKTCIRKGRISTGNPCPICRDEYLVLDHNNIDLLKQFISPQTGDVLSYRVTGLCQKKHT
QLLVAVERAMDRGMLTFDVPFREYDYSEYYPAKEGKPSSK
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtgttgcgcttaatcggtggtgaaatcatatctatttatcgtcaaagtttgctt
acgatcggtaccagccaggcgagggcgctcacgacaactggcttccttcgacacgccgcc
aaacctgaaagtgaagccacagaggaagcagccgccagtgaggaaccggaagcaggggaa
gcagatgcaaatggcgctcccaaacaaccggtcgatgatccgaaggaccgcacgagggtg
ataccggtggagacgagcatccgctatctggccagcgaagcttaccggcagacgtaccag
gacgatccggtgtggaagcagtaccggcgcaatcacaaaggaccgtacccgccgaagctg
acgcgcaaaacgtgcatacgcaaggggcgcatttcgaccggcaatccgtgcccgatctgc
cgcgacgagtatctggtgctagaccacaacaatatcgatctgctgaagcagttcatctcg
ccacaaacgggggatgtgctgagctatcgggtaacgggcctgtgccagaagaaacacacc
cagctgctggtggcggtcgagcgggctatggaccgcggaatgctcacgttcgacgtgccg
ttccgagagtacgactacagtgaatactatccggcgaaggaaggcaagccttcctccaag
tag

DBGET integrated database retrieval system