KEGG   Anopheles gambiae (mosquito): AgaP_AGAP008064Help
Entry
AgaP_AGAP008064   CDS       T01036                                 

Definition
AGAP008064-PA
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aga00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    AgaP_AGAP008064
Enzymes [BR:aga01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     AgaP_AGAP008064
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3R
AA seq 264 aa AA seqDB search
QQSTMRKVVVILKSESENADNYGTLLEKHGYEPVFIPTLDFSFKNLDVLRDRLLSPYKYS
GLIFTSPRSITAVRDALEGQRKLKDDWKTLDNYSVGETSRELIQRTLDLDTKGQHSGNAS
NLADFIKTDLYNKTITMPFLFPCGNLKQDVLQNKLSEYGYSLDSVEVYETVPHRDLERNL
VALFAGEREKEGDRTIDSLLFFSPSGINYCAHVFEKHRIDLTGKRIIAIGPSTKKAIENK
GITVHRTAEKPSPDYVVGALLQDT
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
cagcagagcacgatgcgaaaggtggtggtgatactaaagtcggaaagtgaaaatgcggac
aactatggcacactgctggagaagcacggctacgagcccgtcttcataccgacgctagac
ttttcgttcaaaaacttggacgtgctgcgggatcggctgctgtcgccttacaagtactca
ggccttatctttaccagcccgcgcagcatcacggccgtgcgggacgcgctggagggccag
cgcaagctgaaggacgattggaaaacgctggacaactacagcgttggtgagacgtcccgg
gagctcatccagcgcacgctggacctcgacaccaagggccagcattcggggaatgcgagc
aatttggcggactttatcaaaaccgacctgtataacaaaaccatcacgatgccgttcctg
ttcccctgcggcaatctcaagcaggacgtgctgcagaacaaactgtccgagtatggctac
tcgctcgactcggtggaggtgtacgaaacggtgccacatcgcgacctggaacgaaacctg
gtcgccctgttcgcgggtgagcgagagaaggaaggtgatcggacgatcgatagcttactc
tttttcagcccctccgggattaactactgtgcgcacgtgttcgagaagcatcgcattgat
ctgaccggcaagcgcatcattgcgatcgggccgagcacgaagaaagcgatcgaaaacaag
ggcatcacggtgcaccggacggcggagaagccgtcgcccgactatgtcgttggtgcgctg
ctacaggacacctaa

DBGET integrated database retrieval system