KEGG   Anopheles gambiae (mosquito): AgaP_AGAP008090Help
Entry
AgaP_AGAP008090   CDS       T01036                                 

Definition
AGAP008090-PA
Orthology
K14310  
nuclear pore complex protein Nup205
Organism
aga  Anopheles gambiae (mosquito)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:aga00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AgaP_AGAP008090
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3R
AA seq 2011 aa AA seqDB search
LGSARNNKRFSGSHSVRRGNAFSVVGTPDDLWTPYKCLLNNVETYLLPSTDQADTTHAVA
LEALLRKHKQNFLSLLKNPPKNGKCREAIKQGITEGITLPEFGHTILSKELVDESIILSD
MFDMNEYVALELLCTSQQQTINHPGLTRGLVAVLLYYDGRKSLVASLKQLLKSRAGVSWC
TDAPPEVTQIVTNYTDGLVADGLLERIIDLLQELDITKELDILTTNRALGPPRHHRQVLD
LFEEIRLLLAQCIYYYAAQSGLPRGVTMKLVQFLRGYKCTESSGGIDDVTVTLQMGLLYA
LDLSVLQRREDGEELVRKLPMIKDDLYIDFLMDALSNSWENDGLHALTLFAFGLSIATLR
LAPQTLVQDASKMIDQDELLVNGALQGKVFDFLYYTFLDSELVFDTEFFYRRLHTLFADF
IELMHSKVTELRGRADETARTVQVYQQQGIEPPANLCRNFEMLLLSVGKFYANDRLHLNL
SMEYWGPTEFAHGLQGHRVSSRSVCLFKFIRLAGELLPPTLFIPYLKMLSGLSCNVQAAR
SAFNLLKQGSAYSGSSTVSWDHFFNSLSEYYFNLRQEQNPQSETVYRNRMICKSISPQEI
LGLQAVLQVVQAVAKHDELSRIALCESDKWAPLNVLVGLISCSVPIQLKAEIVRTLASLA
GSLENAIKLWHNLEDSQIVNTIPSTSNFKTRGVISELEEVESRNETFPLTQAMLDLLASL
MRTAIPDDLGEGSRAPGIHPYLSYVVNTVLLRLFSRNYKDGAEKWQLAQKCLQIVHMFVN
GFNFNPANANQMRELKEGRTPPAYRIMLQLNTKSDLLRFILHIIDESIVCFDSYTPFPGK
SSLEAASLLCLQIIEKALNLQEDFFNMHLSTPSPVNLNGINKLLLGVNPRSGTANHMLNI
MKHITYSTWLPGNSLVALRILSIIMTLPDVNQLILGLVTQTDELKNEIRQGFVECLEADL
NVSEEAEPLPLLEQLNDTAWVMGVGPMEDEASSKSTNETFITTSIKGAVIQLIQECLQQP
VVPNLAHYLLGFDLGKDLHLTSLQQPGIMNFPSHCSKSLITLLDKHLEHLRTGNALSTSY
NKLMEYAYRLLYQICRNYHTSEVFLRFLRSCNDFLCRHTTSLPFPDAKNPFLLNQMTFLL
KAIVIELKLTSERNQATQFETICKILLKIINTPTVDPVTSGLGDYYTNTNISFSINATAD
MSTTAIAATKESSETAKRLLCILLDCVDFTIKQLEEPQWNYFNGTVLHELLQSCEMPVTL
KARMRLIDTRKLQDVLRDELDSIQSIATGQRAHIVQEIKTILKYAVDLNTQRSLCASTIK
FLEAWGQVAEVLVCVTPTMIMSLDTKQIIITEILQIMLSKAVPNQIIPELGNIASSTISL
LMVNLRSCFLLKSEQMSLHMLSERHQNGSMNGTSLLSTGGRNGLNGEMNSTAHQRQEGAY
VYLERANALSLKFILKNILDWLLISSDGSPQLKMNLYVALLNYMYIIKGNRDSLERSEKL
DSDKDDGGSFLNRTISNAGRKPYGTETEDYKHLNMIMDIFNSFGDSLIDVICQDCTTGHD
ICKMLAMSCLDMLLSMDASIDIVEFIARHGYLSHIINSLLKKDGDLCHILQTNPSTFRAL
YVYESKMALLTRLARCQIGARMLLEEHILGVLGSMKVYDLHPDQILFPALNLCDAILSTL
GHENNSALSQIIHFFLSHSDMIETVLRAGSPSMNLGLLKELAGITNLIARSANQEIYELT
DPNANQAFGMQLYRMQKFMLALLPRFIVSEQTLKELHQSSMIVQPYASGNDHKQRSQHVK
YFLEVAANLALYTRNCISNHVVDHRTINDTYRSATETSSSDVPHSLYVVITQLRCTVEFY
HKERNVLESLQQQRNSLPSIDLDKNIQLQFNLLTERVTAKQEELQRSVFIIEHYLYILWA
HLDFFMLRVLPVNNRVGSSSFTGHNFQSDKTDSSWRVSNEDIIALKKTLIGVFNETFCKQ
LIEMEQKQSEKGFVVSFIRRIKQSIQFVPVK
NT seq 6036 nt NT seq  +upstreamnt  +downstreamnt
ttaggtagcgcgcggaacaacaaacgcttttcgggctcacattccgttcgccgtggtaat
gctttctctgttgtaggcacgccggacgatctgtggacaccgtacaaatgtctgctgaac
aacgtcgaaacctatctgcttccatcgaccgaccaggccgacacgacgcacgccgtcgcg
ctggaagcgctgctccgcaagcacaagcagaactttctctcgctgctgaaaaacccgccc
aagaacgggaaatgccgggaggcgatcaaacagggcatcaccgaggggatcacgctgccc
gagttcggtcacaccatcctgtccaaagagctggtcgacgagagcatcatcctgtcggac
atgttcgacatgaacgagtatgtggcgctggagctgctgtgcacctcgcagcagcaaacc
atcaaccatccgggactgacgcgcgggctggtcgcggtgctgctgtactacgacgggcgc
aagtcgctcgtggccagcctgaagcagctgctcaaatcgcgtgccggcgtgtcgtggtgc
acggacgcgccgccggaagtaacacagatcgtgaccaactacaccgacgggctggtggcg
gacggtttgcttgagcgcatcatcgatttgctgcaggagttggacattaccaaggagctc
gacatactgacgacgaaccgtgcgctggggccgccgcgccaccatcggcaggtgctggat
ttgttcgaggaaatccggctgctgctggcccagtgcatctactactacgccgcccagtcc
gggttaccgaggggcgtgacgatgaagctggtacagttcctgcgtgggtacaagtgcacg
gaatcgagcggcggcatcgacgacgtgacggtcacgctgcagatgggcctgctgtacgcg
ttggatttgagcgtactgcagcggagagaggacggcgaggagctggtacgcaagctgccg
atgatcaaggacgatctgtacatcgacttcctgatggacgccctgtcgaacagctgggaa
aacgatggtctgcacgcgctgacactgttcgcgtttgggctgtccattgcgacacttcga
ctagcgccgcaaacgctcgtgcaggatgcttcgaaaatgatcgaccaggacgagctgctc
gtgaacggagcgctgcaggggaaggtgttcgacttcctgtactacaccttcctcgacagt
gaactcgtcttcgacacggagttcttctaccgccggctacacacgctgtttgccgacttt
atcgagctgatgcactccaaggtgacggagctgcgtggccgagcggacgaaacggcccga
acggtgcaggtctaccagcagcagggcatcgagccgccggccaacctgtgcaggaacttc
gaaatgctgctcctctcggtcgggaagttctacgccaacgatcggttgcatctgaacctc
agcatggagtactggggcccgaccgagttcgcccacggcctccagggacaccgggtgtca
tcccgctcggtgtgcctgttcaagttcattcggctcgcgggtgaactgctgcctccgacg
ctcttcattccctacctcaagatgctgtccgggcttagctgcaacgtgcaggccgcccgg
agcgcgttcaacctgctcaagcagggcagtgcctactccggcagcagcaccgtctcgtgg
gaccactttttcaactcgctcagcgagtactacttcaacctgcgccaggagcagaaccca
cagtcggaaacggtgtaccgcaatcgtatgatctgcaaaagcatcagcccgcaggaaatt
ctcggcctgcaggctgtgctgcaggtggtgcaagcggtcgccaaacacgacgagctgtct
cgcatcgcgctgtgtgaaagtgacaaatgggcgccactgaacgtgctggttgggctgatc
agctgttccgtgcccattcaactgaaggcggaaatcgtgcgcacccttgcgtcgctagcc
ggaagcttagagaatgcgatcaagctgtggcacaacctggaagactcgcagatcgttaat
acgatcccgtcgacgagcaatttcaaaacgcgtggcgtcatttccgagctggaagaggtt
gaaagtcgcaacgaaacgttcccactcacgcaggccatgctcgatctgctcgcctcgctc
atgaggaccgccattccggacgatctgggtgagggatcacgtgcgcccggcatccatccg
tacctttcgtacgtggtcaacactgtgctgctgcgactgtttagccgtaactacaaggac
ggtgcggaaaagtggcaactggcacagaagtgtctccaaatcgtgcacatgtttgtgaac
ggctttaactttaaccctgccaacgcaaatcagatgagagagctgaaggagggccgcacg
ccaccggcctaccggattatgctgcagctcaacacaaagtccgatctgctgcgcttcatt
ctgcacattatcgatgagtcgatcgtgtgctttgactcgtacacgccgttccccgggaag
agttccctcgaggccgcatcgctgctgtgtctgcagatcattgaaaaggcgctgaacctg
caggaagatttcttcaacatgcatctcagcacaccgagcccggtgaatctgaacggcatc
aacaagctgctgctgggggtgaatccacgtagcggcacggccaatcacatgctgaacata
atgaagcacatcacgtacagtacgtggctgccagggaatagcctggtggcgttgcgtatc
ctttcgatcatcatgacgctgccggacgtgaaccagctaatactcggcctggtgacccaa
accgacgagctgaagaacgagatacggcaaggctttgtggagtgtttggaggccgatttg
aacgtatcggaggaggcggaaccgttgccactgttggaacagctgaacgatacggcctgg
gtgatgggcgttggaccgatggaggacgaagcatcgtccaagagcaccaacgaaacgttc
atcacgacaagcatcaaaggcgcggtcatacagttgattcaggagtgcttgcagcagccc
gttgtgccgaacctggcccactatctgctagggttcgatctggggaaggatttgcacctg
acaagcttgcagcaaccgggcatcatgaacttcccgagccactgttcgaaatcgctcatc
acgctgctggacaaacatttggagcatttacgaaccggaaacgcactgtcgacgagctac
aacaagctgatggagtacgcctatcgactgctgtaccaaatttgccgcaactatcacacc
tcggaagtgtttctgcgctttttgcgctcgtgcaacgattttctttgccggcacacgacg
tcattgcccttcccggatgcgaaaaatccgttcctgctgaaccagatgaccttcctgctg
aaagcgatcgtgatcgagctgaagctgaccagtgagcgcaatcaagcgacgcagttcgaa
acgatttgcaaaattctgctcaaaatcatcaacactccaacggtcgatccggtgacgtcg
gggctgggcgattactacaccaacacgaacataagcttctcgatcaatgccaccgccgac
atgtcgacgacagcaatcgcggccacgaaggaatcaagcgaaacggccaagcgactgctg
tgcattctgctcgactgtgtcgatttcaccatcaagcagctggaggagccgcagtggaac
tacttcaacggcacggtactgcacgagctgctgcaaagctgcgaaatgcccgtcacgctc
aaagctcgcatgcggctgatcgatacgcgcaagctgcaggacgttctgcgcgacgagctc
gactcgatacaatcgatcgcaaccggccagcgggcgcacatcgtgcaggaaattaagacg
atcctgaagtacgcggtggacctgaacacgcagcgcagcctgtgcgcttcgacgataaag
ttcctggaggcgtggggccaggtggcggaggtgctggtatgcgttacgcccaccatgatc
atgtccctcgacacgaagcagatcatcatcacggagatactgcagataatgctgagcaag
gcggtgccgaaccaaatcatccccgagctgggcaacattgcgtcgtccaccatttcgctg
ctgatggtgaatttgcgcagctgcttcctgctcaaatcggaacagatgtcactgcacatg
ctgtccgagcggcatcagaatggcagcatgaacggaacgagtctgctttccaccggtggc
aggaatgggttgaatggtgaaatgaacagcaccgcccatcagcggcaggagggcgcgtac
gtctatctggagcgtgcgaatgcgctgagcttgaagtttattctgaaaaacattctcgac
tggctgctgatcagcagcgacgggtcgccacagttgaaaatgaacctgtacgtcgcgctg
ctaaactacatgtacattatcaagggcaatcgggacagtctcgagcgaagtgagaagctg
gacagcgataaggacgacggtggttcgttcctgaaccgaacaattagcaacgcgggccgc
aaaccgtacggcacggagacggaggactacaagcacctgaacatgataatggacatattc
aactcgttcggggacagcttgatcgacgtgatctgccaggactgtacgaccgggcacgat
atctgcaaaatgctggccatgtcctgtctcgatatgctgctgagcatggatgcttcgatc
gatatagtggagtttatcgcccggcacggctacctatcgcacatcatcaacagtctgctg
aagaaggatggcgacctgtgtcacatcctgcagaccaatccgagcacgttccgcgcgctg
tacgtgtacgagtcgaagatggctctcttgacgcgcctcgcccgctgccagatcggtgcg
cgaatgctgctggaagagcacatccttggagtgctcggaagcatgaaggtgtacgatctg
caccccgatcagatcctgtttcccgcgctgaacctttgcgatgcgatcctgtcgacgctg
ggccacgagaacaactcggcactgagccagatcattcacttcttcctgtcgcatagcgat
atgattgaaacggtgttgcgggcgggctcgccgagcatgaatttgggactgctgaaggag
ctggccggcatcacgaacctaatcgcccggtcggcgaatcaggaaatttacgaactaacg
gacccgaacgcaaaccaagccttcggtatgcagctgtaccggatgcagaagttcatgttg
gcgctgctgccccgcttcatcgtttcggagcagacgctgaaggagctgcaccaaagcagc
atgatcgtgcaaccgtacgcgagcgggaatgaccataagcaacggtcgcagcacgtgaaa
tacttcctcgaggtggccgccaaccttgccctgtacacacgcaactgcatttcgaaccac
gtggtcgaccatcggacgataaatgatacgtaccggtcggcgacggaaacatcgtcgtcg
gatgtgccgcacagcttgtacgtcgtgattacgcagctccggtgtacggtggagttttac
cataaggagcgaaacgtgctggaaagcctacagcaacagcgcaactcactgccgagtatc
gatttagataaaaatattcaattacaatttaatctgctaactgagcgtgtaacggcgaag
caggaagaactgcagcgaagtgtgttcatcatcgagcactatctgtacatcctgtgggcg
catctggactttttcatgctgcgcgtcctgcccgtaaacaatcgcgtcggaagctcttcc
tttaccgggcacaacttccaatccgacaaaacggattccagctggcgggtgtcgaacgag
gacattatcgcactgaaaaagacgctcatcggcgtgttcaacgaaacgttctgcaagcag
ctgatcgagatggagcagaaacaatcggagaagggttttgtggtgtcatttattagacga
attaaacaatccattcagtttgtgccagtcaagtga

DBGET integrated database retrieval system