KEGG   Anopheles gambiae (mosquito): AgaP_AGAP008094Help
Entry
AgaP_AGAP008094   CDS       T01036                                 

Definition
AGAP008094-PA
Orthology
K06170  
presenilin enhancer 2
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Notch signaling pathway
Class
Environmental Information Processing; Signal transduction; Notch signaling pathway [PATH:aga04330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3R
AA seq 101 aa AA seqDB search
MDLSRAPNERKLYLCKWYFKAGFALLPFLWSINTVWFFNEAFRKPAYEEQKEIKKYVIFS
LVGTLVWVVAIISWVVTFQLKRTDWGEFADNISFIIPLGQA
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atggatctatcacgtgccccaaacgaaagaaagctgtatttgtgcaaatggtacttcaaa
gccggattcgcgctgcttcccttcctgtggtccatcaacacggtctggttcttcaacgaa
gcgttccgcaaaccagcctacgaagagcagaaggagattaaaaaatatgtgatattctcg
cttgtaggaacactagtctgggtggtggccattatatcgtgggtagtaacgttccagctg
aagcgaaccgactggggagagtttgcggacaacatcagcttcatcatacccttagggcag
gcgtaa

DBGET integrated database retrieval system