KEGG   Anopheles gambiae (mosquito): AgaP_AGAP008094Help
Entry
AgaP_AGAP008094   CDS       T01036                                 

Definition
(RefSeq) AGAP008094-PA
  KO
K06170  presenilin enhancer 2
Organism
aga  Anopheles gambiae (mosquito)
Pathway
aga04330  Notch signaling pathway
Module
aga_M00682  Notch signaling
Brite
KEGG Orthology (KO) [BR:aga00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    AgaP_AGAP008094
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEN-2 DUF4389
Motif
Other DBs
NCBI-GeneID: 1277857
NCBI-ProteinID: XP_317362
VectorBase: AGAP008094
UniProt: Q7Q3Y1
Position
3R
AA seq 101 aa AA seqDB search
MDLSRAPNERKLYLCKWYFKAGFALLPFLWSINTVWFFNEAFRKPAYEEQKEIKKYVIFS
LVGTLVWVVAIISWVVTFQLKRTDWGEFADNISFIIPLGQA
NT seq 306 nt NT seq  +upstreamnt  +downstreamnt
atggatctatcacgtgccccaaacgaaagaaagctgtatttgtgcaaatggtacttcaaa
gccggattcgcgctgcttcccttcctgtggtccatcaacacggtctggttcttcaacgaa
gcgttccgcaaaccagcctacgaagagcagaaggagattaaaaaatatgtgatattctcg
cttgtaggaacactagtctgggtggtggccattatatcgtgggtagtaacgttccagctg
aagcgaaccgactggggagagtttgcggacaacatcagcttcatcatacccttagggcag
gcgtaa

DBGET integrated database retrieval system