KEGG   Anopheles gambiae (mosquito): AgaP_AGAP008241Help
Entry
AgaP_AGAP008241   CDS       T01036                                 

Definition
AGAP008241-PA
Orthology
K18669  
dual specificity tyrosine-phosphorylation-regulated kinase 2/3/4 [EC:2.7.12.1]
Organism
aga  Anopheles gambiae (mosquito)
Brite
Enzymes [BR:aga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     AgaP_AGAP008241
Protein kinases [BR:aga01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   AgaP_AGAP008241
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3R
AA seq 463 aa AA seqDB search
MDCNAGNSNGGNGSNSNGANGVGANLFTRQHSITGIGGGGNGYSLLLANGGAPVGSSGIP
SSSTSSLRCDKSLAPFEVLRLYMDKLTQYEHHEIYNYPRIYFIGANAKKRRGAGNSDYDN
EQGSYIHIAHDHIAYRYEVLKIIGKGSFGQVVKAYDHRNFQHVALKMIRNEQRFHRQAQE
EIRILKHLRAQDRYNSMNIIHMYDSFVFRNHMCITFELLYINLYELIKKNKFKGFSMQLV
RKFTHSLLKCLDALYKNKIIHCDMKPENILLKQQGRSGIKVIDFGSSCFENERVYTYIQS
RFYRAPEVILGAKYDMAIDMWSLGCIVAELYTGSALLPGEDEYDQMACIIELLGMPPLKL
LHNARWPSRYFAFREDGREEIQGSYSKRGRYRGAPGTRDLAKVLNYCDELFLDFVKHCLR
WDPKRRMTPQEALNHNWFHRMLPQSPQVVKVSDGGSESAASTT
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggactgtaacgctggcaacagtaacggtggcaacggcagcaacagtaacggtgctaac
ggcgtcggtgctaacctcttcacccggcagcactcgataacggggatcggcggcggcggc
aacgggtactcgctgctgttggcaaacggtggtgcaccagtcggctcgtccggcataccg
tccagcagcaccagctcgctgcggtgcgacaagagcttggcaccgttcgaggtgctgcgg
ctgtacatggacaagctgacgcagtacgagcatcacgagatctacaactatccgcgcatt
tacttcatcggtgcgaacgcgaagaagcggcgcggggcgggcaactccgactacgataac
gagcagggctcgtacatccatatcgcgcacgaccacatagcgtaccggtacgaggtgctg
aagatcatcggcaagggcagcttcgggcaggtggtgaaggcgtacgaccatcgcaacttc
cagcacgtggcgctgaagatgatccgcaacgagcagcggttccaccggcaggcgcaggag
gaaattcgcatcctgaagcatctgcgggcgcaggaccggtacaactcgatgaacatcatc
cacatgtacgacagcttcgtgtttcgcaaccacatgtgcatcacgttcgagctgctgtac
atcaacctgtacgagctgatcaagaagaacaagttcaagggcttcagcatgcagctggtg
cgcaagttcacccactcgctgctgaagtgcctggacgcgctgtacaagaacaagatcatc
cattgtgatatgaagccggagaacatcctgctcaagcagcagggccgctcgggcattaag
gtgatcgatttcgggtctagctgcttcgagaacgagcgcgtctacacgtacatccagtcg
cggttctaccgggcgccggaggtgatcctcggcgccaagtacgacatggcgatcgacatg
tggtcgctcgggtgcatcgtggcggagctgtacaccgggtcggcgctgctgcccggcgag
gacgagtacgaccagatggcgtgcattatcgagctgctcggcatgccgccgctcaagctg
ctgcacaatgcccggtggccgtcgcgctacttcgccttccgggaggatgggcgggaggag
atccagggtagctatagcaagcggggacgctaccgcggtgcgcccggcacccgcgatctc
gccaaggtgctgaactactgtgacgagctgttcctcgacttcgtgaagcactgtctgcgg
tgggatccgaagcgccgcatgacgccgcaggaagcgctcaaccacaactggttccaccgg
atgctgccccagtcgccgcaggtggtgaaggtgagcgatggcgggtcggagtcggccgcc
tccacgacg

DBGET integrated database retrieval system