KEGG   Anopheles gambiae (mosquito): AgaP_AGAP008241Help
Entry
AgaP_AGAP008241   CDS       T01036                                 

Definition
AGAP008241-PA
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
aga  Anopheles gambiae (mosquito)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3R
AA seq 463 aa AA seqDB search
MDCNAGNSNGGNGSNSNGANGVGANLFTRQHSITGIGGGGNGYSLLLANGGAPVGSSGIP
SSSTSSLRCDKSLAPFEVLRLYMDKLTQYEHHEIYNYPRIYFIGANAKKRRGAGNSDYDN
EQGSYIHIAHDHIAYRYEVLKIIGKGSFGQVVKAYDHRNFQHVALKMIRNEQRFHRQAQE
EIRILKHLRAQDRYNSMNIIHMYDSFVFRNHMCITFELLYINLYELIKKNKFKGFSMQLV
RKFTHSLLKCLDALYKNKIIHCDMKPENILLKQQGRSGIKVIDFGSSCFENERVYTYIQS
RFYRAPEVILGAKYDMAIDMWSLGCIVAELYTGSALLPGEDEYDQMACIIELLGMPPLKL
LHNARWPSRYFAFREDGREEIQGSYSKRGRYRGAPGTRDLAKVLNYCDELFLDFVKHCLR
WDPKRRMTPQEALNHNWFHRMLPQSPQVVKVSDGGSESAASTT
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggactgtaacgctggcaacagtaacggtggcaacggcagcaacagtaacggtgctaac
ggcgtcggtgctaacctcttcacccggcagcactcgataacggggatcggcggcggcggc
aacgggtactcgctgctgttggcaaacggtggtgcaccagtcggctcgtccggcataccg
tccagcagcaccagctcgctgcggtgcgacaagagcttggcaccgttcgaggtgctgcgg
ctgtacatggacaagctgacgcagtacgagcatcacgagatctacaactatccgcgcatt
tacttcatcggtgcgaacgcgaagaagcggcgcggggcgggcaactccgactacgataac
gagcagggctcgtacatccatatcgcgcacgaccacatagcgtaccggtacgaggtgctg
aagatcatcggcaagggcagcttcgggcaggtggtgaaggcgtacgaccatcgcaacttc
cagcacgtggcgctgaagatgatccgcaacgagcagcggttccaccggcaggcgcaggag
gaaattcgcatcctgaagcatctgcgggcgcaggaccggtacaactcgatgaacatcatc
cacatgtacgacagcttcgtgtttcgcaaccacatgtgcatcacgttcgagctgctgtac
atcaacctgtacgagctgatcaagaagaacaagttcaagggcttcagcatgcagctggtg
cgcaagttcacccactcgctgctgaagtgcctggacgcgctgtacaagaacaagatcatc
cattgtgatatgaagccggagaacatcctgctcaagcagcagggccgctcgggcattaag
gtgatcgatttcgggtctagctgcttcgagaacgagcgcgtctacacgtacatccagtcg
cggttctaccgggcgccggaggtgatcctcggcgccaagtacgacatggcgatcgacatg
tggtcgctcgggtgcatcgtggcggagctgtacaccgggtcggcgctgctgcccggcgag
gacgagtacgaccagatggcgtgcattatcgagctgctcggcatgccgccgctcaagctg
ctgcacaatgcccggtggccgtcgcgctacttcgccttccgggaggatgggcgggaggag
atccagggtagctatagcaagcggggacgctaccgcggtgcgcccggcacccgcgatctc
gccaaggtgctgaactactgtgacgagctgttcctcgacttcgtgaagcactgtctgcgg
tgggatccgaagcgccgcatgacgccgcaggaagcgctcaaccacaactggttccaccgg
atgctgccccagtcgccgcaggtggtgaaggtgagcgatggcgggtcggagtcggccgcc
tccacgacg

DBGET integrated database retrieval system