KEGG   Anopheles gambiae (mosquito): AgaP_AGAP008332Help
Entry
AgaP_AGAP008332   CDS       T01036                                 

Definition
AGAP008332-PA
Orthology
K10739  
replication factor A2
Organism
aga  Anopheles gambiae (mosquito)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:aga00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    AgaP_AGAP008332
   03420 Nucleotide excision repair
    AgaP_AGAP008332
   03430 Mismatch repair
    AgaP_AGAP008332
   03440 Homologous recombination
    AgaP_AGAP008332
   03460 Fanconi anemia pathway
    AgaP_AGAP008332
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3R
AA seq 247 aa AA seqDB search
MNDSFGAGGFNATAGGGGAGNENKAEGVLPLVIEQVLESSDGGISLFGHQYAMITLVAII
RNVDYSSTKVTYQLEDHTGRIDAHLWIEDDGVTSTPSIVPQSYARVVGSVRNQGGSKSIM
IFKIDQINSPNEVTTHLLEVLHARYKGEENSKRKVEGGFDTNANATSNGGFMESDSVGAS
LGLNGKQLAVYKAIKSHVSDIGISRKELQAKFSHISPSEMQSIIDHMGQEGMIYTTVDTD
HFFCVDA
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgaacgatagctttggtgccggtggatttaacgcgaccgcgggcggcggcggtgcggga
aatgagaacaaagcggaaggcgtcctgccgctcgtcatcgagcaggtgctggaatcatcg
gacggaggcatttcgctgttcgggcaccaatatgcgatgattacgctggttgcaatcatc
cgcaatgtcgattactcctccaccaaagtcacctaccagctggaagatcacacaggccga
attgatgcacatctatggatagaggacgacggtgtcaccagcacgccgagtatcgtgccc
cagtcgtacgctcgcgtggttggatcggtgcgcaatcagggcggctcgaaatcgatcatg
atcttcaagatcgaccagatcaactccccgaacgaggtgaccacccatctgctggaggtg
ctgcacgcccggtacaagggcgaggagaacagcaagcgcaaggtggagggtgggttcgac
acgaacgccaatgcgacctcgaacggtgggttcatggaatcggactcggtcggtgcgtcg
ctgggcctgaacgggaagcagctggctgtgtacaaagcgatcaaaagccacgtatccgac
atcggcatcagccgcaaggagctgcaggccaaattttctcacatcagtccctcggagatg
cagagtatcattgatcatatgggacaggaaggcatgatatacaccacggtcgatacggat
catttcttctgtgtggacgcataa

DBGET integrated database retrieval system