KEGG   Anopheles gambiae (mosquito): AgaP_AGAP008401Help
Entry
AgaP_AGAP008401   CDS       T01036                                 

Definition
(RefSeq) AGAP008401-PA
  KO
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aga00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AgaP_AGAP008401
   00053 Ascorbate and aldarate metabolism
    AgaP_AGAP008401
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    AgaP_AGAP008401
   00860 Porphyrin and chlorophyll metabolism
    AgaP_AGAP008401
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    AgaP_AGAP008401
   00982 Drug metabolism - cytochrome P450
    AgaP_AGAP008401
   00983 Drug metabolism - other enzymes
    AgaP_AGAP008401
Enzymes [BR:aga01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     AgaP_AGAP008401
Glycosyltransferases [BR:aga01003]
 Others
  Hydrophobic molecule
   AgaP_AGAP008401
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
VectorBase: 
UniProt: 
Position
3R
AA seq 1042 aa AA seqDB search
FFQRHFSLLLIAVLGVIGFLPQSGNGAKILLVSAFPGMSHWLMFEHIIHELLRRGHELTA
ISSYRLRTDGANYTDRYHEVLIEPIYDFEANGLPMEVFYKSQSFGDPFFKMSILWKLGLE
TAEHAFESANVRTFLQREGLTFGLLIAEQFVQEAFLMFAHKYRVPIVTINTLGHADYIDR
AFGLLTPWSFVPHFMVQYDDQMTMTERAYNVFLSAWDAYNRKFYYLPEQRKLAEKYFGAE
NATSSLPSIEDLERNVSVVLVNNHIISSRPRPRINGMIDIAGVHIRKAKPLPPVLQNFLD
AAPGGVIYINFGTFLRSSGMPPETLAVFLALFRSLPQYSFLWKWEADTIPNLPPNVLLQR
WIPQNDVLAHPHVKLFVSHGGIFGTQESIYWARPILFVPFYGDQHSNALKFERAGIGLTL
QIINVTVEDFRAKIERIVQQPTFQQSVNRLSAIFRDNPTDPLEEAAFWVEYVVRHRGAAH
LKSAAVQMPWYRYLLLDILSLTLLVHFRALSYIIGCAVAFTALGPPSVECGKILFLVPFP
APSHWLWIEHFVKELLSRGHEVTAITNFPAKEAHRNYTEILIDPPYDIPYYFPVSDIYDS
KYNSDLNNLFLYWRVGISTTQYALEDENVQQFIEQDDTDFDVIISEQFYQEAFLMFAHKY
RAPIVTLCTLGHANHIDQAMGLVTPWSFVPHPVLLLSDDMTFSERCYNFLISLADLVIRQ
LYYIPQQNRLAQIHFAKIEGPELMPSIRDLEKSISVILVNSHLSTSPPRPTIPGLVNVAG
AHIKPAKELPDDIRKFLDGAKEGVIFFSLGSYMKSADMPKDKMKAFLEVFRNIKQRVLWK
YENEDVARLPKNVMVRKWLPQSDILAHPKVVLFITHGGMFGSQEGIYRGVPMLYIPFYGD
QHRNALKAEQAGYALTLNFPEVNVITLGSRINELLTNPTFMKQAKRASELFRDNLVPPMQ
EAMHWIEYVMRHKGAKHLKTRAIDLSWTQYLMVDVVGFFALVFLLAAVVFYKVLGLFLTP
PKPKSKPKTRDMMLGMRKPKLN
NT seq 3129 nt NT seq  +upstreamnt  +downstreamnt
ttttttcagagacacttcagcttgttgttgattgcagtgttgggtgtgatcggcttccta
ccgcaaagtggcaatggagcaaagattctgctcgtttcggccttccccggcatgagccac
tggctgatgttcgagcacatcatacacgagctgctgcggcgaggtcacgaactgacggcc
atcagtagctatcggttgcgaacggacggtgccaactataccgaccgctaccacgaggta
ctgatcgagccgatatacgacttcgaagcgaacgggctgccgatggaagtgttttacaaa
tcgcaatcgttcggtgatccgttcttcaagatgtcgatactgtggaagctggggctggaa
acggcggagcacgcgttcgagagtgcgaatgtgcggacgttcctgcaacgggagggtctc
acgtttggtctgctaatagcggagcagtttgtgcaggaagcgtttctgatgtttgcgcac
aagtaccgagtgccgatcgtcactatcaatacgttagggcatgcggactatatcgatcgt
gcgttcgggttgctaacgccgtggtctttcgtaccacactttatggtacagtacgatgat
cagatgacgatgaccgagagagcgtacaacgtgttcctgtctgcgtgggatgcgtacaat
cggaagttttactaccttcccgagcagcggaagctggcggagaagtactttggagcggaa
aatgcaacctccagcctgcccagcatagaagatctcgaacggaacgttagtgtggtgctt
gtgaacaatcacatcatctcatcccgtccaagaccacggatcaacgggatgatcgatatt
gctggggttcacatcaggaaagcaaaaccacttccaccagtcttacagaacttcctggat
gcagcacccggtggcgtcatctacatcaacttcggtaccttcctgcgaagctcgggcatg
cccccggaaaccctagccgtcttcctggccctgtttcgtagcctcccccagtacagcttc
ctgtggaaatgggaagccgacacaatccccaaccttccgcccaacgttctcctccagcgc
tggatcccccagaacgacgtgctggctcatccgcacgtgaagctctttgtatcgcacggt
ggcatcttcggcacgcaggaatccatctactgggcccgcccaatactgttcgtcccgttc
tatggcgatcagcacagcaatgcgctaaagtttgagcgtgccggcattggcctaacgctc
caaataatcaacgttacggtggaggactttcgggcgaagatagagcgcatcgtgcagcag
cctacgttccagcagagtgtcaaccggctgtcggcaatctttcgcgataatccaaccgat
ccgcttgaggaggccgcgttctgggtcgagtatgtcgtgcgccatcggggagccgctcat
ctgaagtcggccgcagtacagatgccctggtatcggtatctgctgctggacatcttgtca
ttgaccttgctggtacatttccgcgcactgtcgtacataatcggttgtgctgttgcattt
accgccctcggtccaccgtctgtcgaatgtggcaagatactgttcctcgtcccattccca
gcaccatcccactggctgtggatagagcacttcgttaaggagctgctgtcccgggggcac
gaggtaacggcgatcactaacttccctgcgaaggaagcgcaccgcaactacacggaaata
ctgatcgatccaccgtacgatataccttactactttcccgtgtcggatatctacgattcg
aagtacaacagtgatcttaacaacctgttcctctactggagggtaggcatctcgacgaca
cagtacgcgctggaggacgagaatgtgcagcagttcatcgagcaggacgatacggacttt
gatgtgatcatctcggagcagttctatcaggaagcgttcctcatgtttgcccacaagtac
cgggcgccgatcgtgacgctctgcacccttgggcatgcaaatcacatcgatcaagcgatg
ggactcgttacaccgtggtcatttgttcctcacccggtactgctgctgtccgacgatatg
acattctccgagcggtgctacaactttctgatctcactggccgatctggtgatacggcag
ctttactacatcccccagcagaacaggctcgctcagatacactttgccaaaatagaaggt
cccgagctgatgccttcgattcgagatctcgaaaagtccatctctgtgatactggtcaac
agtcacctgtcgacgtcacccccgcgacccaccatccccggcctggtgaatgtggccggc
gcacacatcaagccggcaaaagagctacccgacgacatccggaagttcctggacggtgcc
aaagagggcgtcatcttcttcagcctcggctcgtacatgaagagcgccgacatgcccaag
gacaagatgaaagcgttcctggaggtgttccgcaatatcaagcagcgcgtactgtggaag
tacgaaaacgaggacgttgcccggctgccgaaaaacgtgatggtgcgcaagtggctaccc
caaagcgacatcctagcccacccgaaggtggtactgttcatcacgcacggcggtatgttt
ggcagccaggagggcatctaccgcggagtgcccatgctgtacataccgttctacggggat
cagcatcgcaatgcgctcaaggcggagcaggcaggctacgcactgacgctcaacttcccc
gaggtgaacgtcatcacgctcggttcgcgcattaacgagctgctcacgaacccgacgttc
atgaagcaggcaaaacgggcgtcggaactgttccgggacaatctcgtgccgccgatgcag
gaagcgatgcactggatcgagtacgtgatgcggcacaagggcgcaaagcatctgaagacg
cgcgcgatcgacctgtcctggacgcagtacctgatggtggatgtggtcgggttctttgcg
ctcgtgtttctgctcgcggcggtcgtgttttacaaagtgctggggctgttcctgacacca
ccgaagccgaaatcgaaaccaaagacccgggacatgatgctcgggatgaggaagccgaag
ttaaactaa

DBGET integrated database retrieval system