KEGG   Anopheles gambiae (mosquito): AgaP_AGAP008401Help
Entry
AgaP_AGAP008401   CDS       T01036                                 

Definition
AGAP008401-PA
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aga00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    AgaP_AGAP008401
   00053 Ascorbate and aldarate metabolism
    AgaP_AGAP008401
   00500 Starch and sucrose metabolism
    AgaP_AGAP008401
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    AgaP_AGAP008401
   00860 Porphyrin and chlorophyll metabolism
    AgaP_AGAP008401
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    AgaP_AGAP008401
   00982 Drug metabolism - cytochrome P450
    AgaP_AGAP008401
   00983 Drug metabolism - other enzymes
    AgaP_AGAP008401
Enzymes [BR:aga01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     AgaP_AGAP008401
Glycosyltransferases [BR:aga01003]
 Others
  Hydrophobic molecule
   AgaP_AGAP008401
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3R
AA seq 1042 aa AA seqDB search
FFQRHFSLLLIAVLGVIGFLPQSGNGAKILLVSAFPGMSHWLMFEHIIHELLRRGHELTA
ISSYRLRTDGANYTDRYHEVLIEPIYDFEANGLPMEVFYKSQSFGDPFFKMSILWKLGLE
TAEHAFESANVRTFLQREGLTFGLLIAEQFVQEAFLMFAHKYRVPIVTINTLGHADYIDR
AFGLLTPWSFVPHFMVQYDDQMTMTERAYNVFLSAWDAYNRKFYYLPEQRKLAEKYFGAE
NATSSLPSIEDLERNVSVVLVNNHIISSRPRPRINGMIDIAGVHIRKAKPLPPVLQNFLD
AAPGGVIYINFGTFLRSSGMPPETLAVFLALFRSLPQYSFLWKWEADTIPNLPPNVLLQR
WIPQNDVLAHPHVKLFVSHGGIFGTQESIYWARPILFVPFYGDQHSNALKFERAGIGLTL
QIINVTVEDFRAKIERIVQQPTFQQSVNRLSAIFRDNPTDPLEEAAFWVEYVVRHRGAAH
LKSAAVQMPWYRYLLLDILSLTLLVHFRALSYIIGCAVAFTALGPPSVECGKILFLVPFP
APSHWLWIEHFVKELLSRGHEVTAITNFPAKEAHRNYTEILIDPPYDIPYYFPVSDIYDS
KYNSDLNNLFLYWRVGISTTQYALEDENVQQFIEQDDTDFDVIISEQFYQEAFLMFAHKY
RAPIVTLCTLGHANHIDQAMGLVTPWSFVPHPVLLLSDDMTFSERCYNFLISLADLVIRQ
LYYIPQQNRLAQIHFAKIEGPELMPSIRDLEKSISVILVNSHLSTSPPRPTIPGLVNVAG
AHIKPAKELPDDIRKFLDGAKEGVIFFSLGSYMKSADMPKDKMKAFLEVFRNIKQRVLWK
YENEDVARLPKNVMVRKWLPQSDILAHPKVVLFITHGGMFGSQEGIYRGVPMLYIPFYGD
QHRNALKAEQAGYALTLNFPEVNVITLGSRINELLTNPTFMKQAKRASELFRDNLVPPMQ
EAMHWIEYVMRHKGAKHLKTRAIDLSWTQYLMVDVVGFFALVFLLAAVVFYKVLGLFLTP
PKPKSKPKTRDMMLGMRKPKLN
NT seq 3129 nt NT seq  +upstreamnt  +downstreamnt
ttttttcagagacacttcagcttgttgttgattgcagtgttgggtgtgatcggcttccta
ccgcaaagtggcaatggagcaaagattctgctcgtttcggccttccccggcatgagccac
tggctgatgttcgagcacatcatacacgagctgctgcggcgaggtcacgaactgacggcc
atcagtagctatcggttgcgaacggacggtgccaactataccgaccgctaccacgaggta
ctgatcgagccgatatacgacttcgaagcgaacgggctgccgatggaagtgttttacaaa
tcgcaatcgttcggtgatccgttcttcaagatgtcgatactgtggaagctggggctggaa
acggcggagcacgcgttcgagagtgcgaatgtgcggacgttcctgcaacgggagggtctc
acgtttggtctgctaatagcggagcagtttgtgcaggaagcgtttctgatgtttgcgcac
aagtaccgagtgccgatcgtcactatcaatacgttagggcatgcggactatatcgatcgt
gcgttcgggttgctaacgccgtggtctttcgtaccacactttatggtacagtacgatgat
cagatgacgatgaccgagagagcgtacaacgtgttcctgtctgcgtgggatgcgtacaat
cggaagttttactaccttcccgagcagcggaagctggcggagaagtactttggagcggaa
aatgcaacctccagcctgcccagcatagaagatctcgaacggaacgttagtgtggtgctt
gtgaacaatcacatcatctcatcccgtccaagaccacggatcaacgggatgatcgatatt
gctggggttcacatcaggaaagcaaaaccacttccaccagtcttacagaacttcctggat
gcagcacccggtggcgtcatctacatcaacttcggtaccttcctgcgaagctcgggcatg
cccccggaaaccctagccgtcttcctggccctgtttcgtagcctcccccagtacagcttc
ctgtggaaatgggaagccgacacaatccccaaccttccgcccaacgttctcctccagcgc
tggatcccccagaacgacgtgctggctcatccgcacgtgaagctctttgtatcgcacggt
ggcatcttcggcacgcaggaatccatctactgggcccgcccaatactgttcgtcccgttc
tatggcgatcagcacagcaatgcgctaaagtttgagcgtgccggcattggcctaacgctc
caaataatcaacgttacggtggaggactttcgggcgaagatagagcgcatcgtgcagcag
cctacgttccagcagagtgtcaaccggctgtcggcaatctttcgcgataatccaaccgat
ccgcttgaggaggccgcgttctgggtcgagtatgtcgtgcgccatcggggagccgctcat
ctgaagtcggccgcagtacagatgccctggtatcggtatctgctgctggacatcttgtca
ttgaccttgctggtacatttccgcgcactgtcgtacataatcggttgtgctgttgcattt
accgccctcggtccaccgtctgtcgaatgtggcaagatactgttcctcgtcccattccca
gcaccatcccactggctgtggatagagcacttcgttaaggagctgctgtcccgggggcac
gaggtaacggcgatcactaacttccctgcgaaggaagcgcaccgcaactacacggaaata
ctgatcgatccaccgtacgatataccttactactttcccgtgtcggatatctacgattcg
aagtacaacagtgatcttaacaacctgttcctctactggagggtaggcatctcgacgaca
cagtacgcgctggaggacgagaatgtgcagcagttcatcgagcaggacgatacggacttt
gatgtgatcatctcggagcagttctatcaggaagcgttcctcatgtttgcccacaagtac
cgggcgccgatcgtgacgctctgcacccttgggcatgcaaatcacatcgatcaagcgatg
ggactcgttacaccgtggtcatttgttcctcacccggtactgctgctgtccgacgatatg
acattctccgagcggtgctacaactttctgatctcactggccgatctggtgatacggcag
ctttactacatcccccagcagaacaggctcgctcagatacactttgccaaaatagaaggt
cccgagctgatgccttcgattcgagatctcgaaaagtccatctctgtgatactggtcaac
agtcacctgtcgacgtcacccccgcgacccaccatccccggcctggtgaatgtggccggc
gcacacatcaagccggcaaaagagctacccgacgacatccggaagttcctggacggtgcc
aaagagggcgtcatcttcttcagcctcggctcgtacatgaagagcgccgacatgcccaag
gacaagatgaaagcgttcctggaggtgttccgcaatatcaagcagcgcgtactgtggaag
tacgaaaacgaggacgttgcccggctgccgaaaaacgtgatggtgcgcaagtggctaccc
caaagcgacatcctagcccacccgaaggtggtactgttcatcacgcacggcggtatgttt
ggcagccaggagggcatctaccgcggagtgcccatgctgtacataccgttctacggggat
cagcatcgcaatgcgctcaaggcggagcaggcaggctacgcactgacgctcaacttcccc
gaggtgaacgtcatcacgctcggttcgcgcattaacgagctgctcacgaacccgacgttc
atgaagcaggcaaaacgggcgtcggaactgttccgggacaatctcgtgccgccgatgcag
gaagcgatgcactggatcgagtacgtgatgcggcacaagggcgcaaagcatctgaagacg
cgcgcgatcgacctgtcctggacgcagtacctgatggtggatgtggtcgggttctttgcg
ctcgtgtttctgctcgcggcggtcgtgttttacaaagtgctggggctgttcctgacacca
ccgaagccgaaatcgaaaccaaagacccgggacatgatgctcgggatgaggaagccgaag
ttaaactaa

DBGET integrated database retrieval system