KEGG   Anopheles gambiae (mosquito): AgaP_AGAP008417Help
Entry
AgaP_AGAP008417   CDS       T01036                                 

Definition
AGAP008417-PA
Orthology
K06634  
cyclin H
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Basal transcription factors
Nucleotide excision repair
Module
Holo-TFIIH complex
Brite
KEGG Orthology (KO) [BR:aga00001]
 Genetic Information Processing
  Transcription
   03022 Basal transcription factors
    AgaP_AGAP008417
  Replication and repair
   03420 Nucleotide excision repair
    AgaP_AGAP008417
Transcription machinery [BR:aga03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIH
     AgaP_AGAP008417
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3R
AA seq 333 aa AA seqDB search
MYSLSSQKKFWTFKTEQELAELRVKQNVRFIAKHGASMTEEQRQAHFLSADEERLLLKQY
ELQLKEFCKRFEPPMPKYVVGTAFHYFKRFYLNNSSMDYHPKEILATCVYLACKVEEFNV
SIAQFVANIKGDRVKAMDIILSNELLLMQELNYYLTIHNPMRPIEGFLIDIKTRCNMSNP
DRLRPGIEDFIDKTFLTDAPLMYAPSQIALAAVLHAASKEQENLDSYVTESLFGSAKDKL
PVLIEAVRRVRSMVRTIELPPKDRVRFLEKKLEKCRNQENNPDSQIYKQRMKKMYEDEDD
LDVMGSSYHMNVSDASLDVSQLNTTNPANMTID
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgtattcccttagctcgcagaaaaagttctggactttcaaaaccgagcaggagctggcc
gagctgcgtgtgaaacaaaacgttcgctttattgccaagcatggggccagcatgacggaa
gaacagaggcaggcgcacttcctgtctgcggatgaggagcgattattgctgaaacagtat
gagctacagttgaaagagttctgcaaacggttcgagccaccgatgcccaaatacgtcgtg
gggacagcattccactactttaagcggttttatctgaacaactcgtcaatggactatcat
ccgaaggaaattttggcaacatgcgtttatttggcctgcaaggtggaagagttcaacgtt
tccatcgcacagtttgtggccaacattaagggcgatcgggtcaaagcgatggacattatt
ctgtcgaacgagctgttgctgatgcaggagctcaactactacctcacgatacacaatccg
atgagacctatagaaggatttctaatcgatattaagacccgatgtaacatgagcaatccc
gatcgtttgcggcccgggatagaagatttcatcgacaaaacgtttctaaccgatgcgccc
ctgatgtacgcaccgtcacagatagctctggcggccgttctgcacgccgccagcaaggag
caggagaatctagacagctacgttacggaatcgttgtttgggtcggctaaggacaagctg
ccggtgttgattgaagccgtccggagagttcgctcgatggtgcgcacgatcgaactgccg
ccaaaggaccgggtacggtttctggagaagaagctggaaaaatgtcgcaaccaggagaac
aaccccgacagccagatctacaaacaacgcatgaagaaaatgtacgaagacgaagacgat
ctggacgttatggggtcttcgtaccatatgaacgtttcggatgcaagcctggacgtttcg
cagctaaacaccaccaatccggcaaacatgactatcgattaa

DBGET integrated database retrieval system