KEGG   Anopheles gambiae (mosquito): AgaP_AGAP008440Help
Entry
AgaP_AGAP008440   CDS       T01036                                 

Definition
AGAP008440-PA
Orthology
K00365  
urate oxidase [EC:1.7.3.3]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Purine metabolism
Caffeine metabolism
Metabolic pathways
Module
Purine degradation, xanthine => urea
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:aga00230]
Metabolism; Biosynthesis of other secondary metabolites; Caffeine metabolism [PATH:aga00232]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3R
AA seq 326 aa AA seqDB search
MSRKLIDESREGYLENENSPFLISNYGYGKDSVKVMHVVRSGLVHTIKEFEVGTKLKLRS
QKDYLEGDNSDIVATDSQKNTVYLLARKHGLKSPEEFGILLCHHFLSKYSHVEEVSIHIE
EYPWSRMGFGTGPYKDLHNHAFVFTPTAIRYTDVTQKRTEIKPTVISGLTDLRVLKTTQS
AFVNFVNDEYRSLPDQHDRIFSTVVRSSWQYSTVTGVDFDYCWNKVKQCILNNFAGETEK
GIFSPSVQNTLYLAEKQVLETIPEISSIDMTMPNKHYFTFDFSKFPKVVNEVELKEETVY
VPVDKPAGIIYAQLDRKSDQYVKSKL
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgtccagaaagctgatcgatgaaagccgggaaggatacctggagaatgaaaactccccc
ttcctgatcagcaactacgggtacggcaaggacagcgtgaaggtgatgcacgtggtgcgc
agcgggctggtgcacacgataaaagagtttgaggtgggcacaaagctgaagctacgcagc
cagaaggactatcttgagggcgataacagtgacattgtggcaacggattcgcagaaaaac
accgtctacctgttggcgcgcaagcacggcctcaagtcaccggaagagtttggcatcctg
ctgtgtcatcactttctcagcaagtactcgcacgtggaggaggtgtcgatacacatcgag
gagtatccgtggtcgcggatgggcttcggtaccggcccgtacaaggatctgcataatcac
gcgttcgtcttcacgccgaccgccatccggtacacggacgtcacgcagaagcgaaccgaa
atcaaaccgaccgtcatcagtgggctgacggatttgcgcgtcctcaagacgacacagtcg
gcgttcgtgaactttgtcaacgatgagtatcgctcgctgcccgaccagcacgaccgtatc
ttcagcacggtggtccgttcctcctggcagtactcgaccgtgacgggcgttgattttgat
tactgctggaacaaggtgaagcagtgcatcctgaacaactttgcgggcgaaacggagaag
ggcatcttttcgccgagcgtccagaacacgctctacctggcggagaagcaggtgctggag
acgataccggaaatttcgtccatcgacatgacgatgccaaacaagcactacttcacgttc
gacttcagcaagttcccgaaggtggtgaacgaggtcgagctgaaggaggagacggtgtac
gtgccggtggacaagccggcgggcatcatctacgcccagctcgatcggaaatcggatcag
tacgtgaagagtaagctgtga

DBGET integrated database retrieval system