KEGG   Anopheles gambiae (mosquito): AgaP_AGAP008530Help
Entry
AgaP_AGAP008530   CDS       T01036                                 

Definition
AGAP008530-PA
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:aga00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    AgaP_AGAP008530
Enzymes [BR:aga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     AgaP_AGAP008530
Peptidases [BR:aga01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   AgaP_AGAP008530
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3R
AA seq 1122 aa AA seqDB search
AMDFDKTVEAMDTQDDNEIDPPNIQNLTNAVAAAPPAPTSEAVVAAVAAAAVAAANGASA
DGGGEAMALDDQDFLNDEVRSEATFSYVITKFSRLTESILSPPVYVRNLPWKILAMPRNN
DNSVSPAKGLGFFLQCNGESTSNNWNCSASAELRLLKADRSAEPFIRRIRHTFCMQENDW
GFSSFMNWQEILDPANGFIENDTITLEVYVNAEPPRGIFWDSKKHTGYVGLKNQGATCYM
NSLLQTLYFTNQLRKAVYKMPTEADDDCKSVALALQRVFHDLQTQNKPVGTKKLTKSFGW
DALDSFMQHDVQEFLRVLLDKLENKMKGTSLEGTIPKLFEGKMISYIKCQNIDYTSRRTE
TFYDIQLNIKGKKNIQESFKDYIATEILDDDNKYDAGEHGLQKAEKGILFMKFPPVLHLH
LMRFQYDPISDNSVKFNDRFEFDEKINLDPFLESHEETPATYILHAVLVHSGDNHGGHYV
VYINPKNDGKWCKFDDDVVCRCSRNEAIEQNYGGHDNELNMRHSSNAYMLVYVRESVVHQ
VLEEVKESDIPEELLERLNEQRRIQQVRRTERTEASNFVNLNILLADYMEVHQKSDLFDA
TTAAYRTLKVRKTTDLASVVQQVGRAFKVDQYRLWEVKKPANQKPHKFEYIDPASTETCA
KYASPETKHSCTIFLELPLPGRTELEPAKITFEDTLLFFKFYDPVEKRLNYCGHGLYKPS
TTVAELVRGLNKRAYFEPDTELQLYEVVDINKAQKITDQFQTLQTALSFLCHGTIVVFEK
LHPPQDNLEFPTCEAYFKDLFCRMEVIFLDTLIPNDTGFTLDLSSESTYDQIAKAVGRRI
NVNPYEIQFFKSKNYSDLPGQPLSHSYAGSLREVLQYSKTKTIRKLFYQKLSININELEN
KKQFRCLYLMPNLKEEKELILYPNKNGTVRDLLEEARKVIEFAEASTKQLRISELSKNRL
SPGPADDTPLDQLHDYTENPFVQKSSIGNQTMYRIEEVAEDEVALGEHEMLVPVLHFTKD
ISSVFGIPFFIRTVQDETFASLKERMKKKLGVSDKEWEKYRLAIITEHIDYIDDEMIQIK
LETFRGDPSDPHSRTFLGLEHINKNTKRSRFNYMEKAIKIYN
NT seq 3369 nt NT seq  +upstreamnt  +downstreamnt
gctatggattttgacaaaaccgtggaagcgatggacacgcaagacgacaatgaaatcgat
ccgcccaacattcagaacctcacgaacgcggtcgccgcagcaccaccagccccgacgtca
gaggccgtcgtcgccgcagtggcggcagccgccgtcgccgccgccaacggtgcgagcgcg
gacgggggcggggaagcgatggcgctggacgatcaggacttcctgaacgacgaggtgcgg
tcggaggccacgttcagctatgtgataacgaagttcagccggctgaccgagtcgatactg
tcgccgccggtgtacgtgcgcaacctgccgtggaagatactggcgatgccgcgcaacaac
gacaactcggtgtcgcccgccaaggggctcggcttcttcctgcagtgcaacggcgagagc
accagcaacaactggaactgctccgcgtcggccgagctgcggctgctgaaggcggaccgg
agcgcggaaccgttcatccgccggatccggcacacgttctgcatgcaggagaacgactgg
ggcttctcgtcgttcatgaactggcaggagatactggacccggcgaacgggttcatcgag
aacgacacgatcacgctggaggtgtacgtgaacgcggagccgccgcgcggcatcttctgg
gactcgaaaaagcacaccgggtacgtggggctgaagaaccagggcgccacctgctacatg
aactcgctgctgcagacgctctacttcaccaaccagctgcggaaggcggtgtacaagatg
ccgaccgaggcggacgacgactgcaagtcggtggcgctcgcgctgcagcgcgtcttccac
gacctgcagacgcagaacaaaccggtcggcacgaagaagctgaccaagagcttcggctgg
gacgcgctcgactcgttcatgcagcacgacgtgcaggagtttctgcgcgtgctgctggac
aagctggagaacaagatgaagggcaccagcctggagggcacgatcccgaagctgttcgag
ggcaagatgatctcgtacatcaagtgccagaacatcgactacaccagccggcgcacggaa
acgttctacgacatccagctgaacatcaaggggaagaaaaacatccaggaatcgttcaag
gactacatcgcgacggagatcctggacgacgacaacaagtacgacgcgggcgagcacggc
ctgcagaaggcggagaagggcatcctgttcatgaagttcccgcccgtgctgcacctgcac
ctgatgcgcttccagtacgatccgatctcggacaattcggtcaagtttaacgatcgcttc
gagttcgacgagaagatcaacctggacccgttcctggagtcgcacgaggagacgccggcc
acgtacatactgcacgcggtgctggtccactccggcgacaaccacggcggccactacgtg
gtctacatcaacccgaagaacgacggcaagtggtgcaagttcgacgacgatgtggtgtgc
cggtgcagccgcaatgaggcgatcgagcagaactacggcgggcacgacaacgagctgaac
atgcgccacagcagcaacgcgtacatgctggtgtacgtgcgcgaatcggtcgtgcaccag
gtgctggaggaggtgaaggagagcgacatcccggaggagctgctcgagcggctgaacgag
cagcggcgcatccagcaggtgcggcgcacggagcgcaccgaggcgtccaacttcgtcaac
ctgaacatcctgctcgcggactacatggaggtgcaccagaagtcggacctgttcgacgcg
acgacggccgcgtaccgcacgctcaaggtgcgcaagacgaccgaccttgcctcggtggtg
cagcaggtcgggcgcgcgttcaaggtcgaccagtaccggctgtgggaggtgaagaagccc
gccaaccagaagccgcacaagttcgagtacatcgatccggcgtcgacggagacgtgcgcc
aagtacgcgtcgcccgagacgaagcactcgtgcacgatcttcctcgagctgccgctgccg
ggccggaccgagctcgagccggccaaaatcacgttcgaggacacgctgctgttcttcaag
ttctacgatccggtggagaagcggctgaactactgcggccacggtctgtacaaaccgtcg
acgacggtcgccgagctggtgcgcgggctgaacaagcgcgcctacttcgagccggacacc
gagctgcagctgtacgaggtggtggacattaacaaggcgcagaaaatcacggaccagttc
cagacgctgcagaccgccctgtccttcctctgccacggcacgatcgtggtgttcgagaag
ctgcacccgccgcaggacaatctcgagtttccgacgtgcgaggcgtacttcaaggatctg
ttctgccgcatggaggtcatctttctcgacacgctcatcccgaacgataccggcttcacg
ctcgacctgtcgtccgagtcgacgtacgaccagatcgcgaaggcggtcggccgccgcatc
aacgtcaacccgtacgagatacagttcttcaagagcaaaaactacagcgacctgcccggg
cagccgctgtcgcacagctacgccggctcgctgcgggaggtgctgcagtacagcaagacg
aaaacgatccgcaagctgttctaccagaagctctcgatcaacatcaacgagctggagaac
aagaagcagttccgctgcctctacctgatgccgaacctgaaggaggagaaggagctgatc
ctctacccgaacaagaacggtaccgtgcgcgacctgctcgaggaggcccggaaggtgatc
gagttcgcggaggcgagcacgaagcagctgcggatttccgagctgtcgaagaaccggctg
tcgcccgggccggccgacgatacgccgctcgaccagctgcacgactacaccgagaacccg
ttcgtgcagaagtcgagcatcggcaaccagacgatgtaccgcatcgaggaggtggccgag
gacgaggtggcgctcggcgagcacgagatgctcgtgccggtgctgcacttcaccaaggac
atctcgagcgtgttcggcataccgttcttcatacgcaccgtgcaggacgaaacgttcgcc
tcgctgaaggagcgcatgaagaagaagctgggcgtgtcggacaaggagtgggagaagtac
cggctagcgatcatcaccgagcacatcgactacatcgacgacgagatgatacagatcaag
ctggaaacgttccggggcgatccgagcgacccgcactcccggaccttcctcgggctggag
cacatcaacaaaaacaccaaacgcagcaggttcaactacatggaaaaggcgatcaagatt
tacaactag

DBGET integrated database retrieval system