KEGG   Anopheles gambiae (mosquito): AgaP_AGAP008783Help
Entry
AgaP_AGAP008783   CDS       T01036                                 

Definition
AGAP008783-PA
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:aga00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    AgaP_AGAP008783
  Amino acid metabolism
   00330 Arginine and proline metabolism
    AgaP_AGAP008783
Enzymes [BR:aga01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     AgaP_AGAP008783
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3R
AA seq 351 aa AA seqDB search
MLPRIALARLVGRTGVTFGASTSSYCTSTADHSFATIKPKKINYERIGIVGVPFDKGQRK
KGVGLGPKAIREAGLIDHIQEISPKLNIKDYGDIQYEALNFQGRKVGNMKKLEHVASCSR
NLSHQVTEVLDDDRLCITLGGDHAIAIGSIDGHLHHSKDVAVIWVDAHADLNTNSTSPSG
NIHGMPVALLARELCDYWPYIPGMDWQEPIISIKNLAYIGLRSVDPYERAIIEKFGINAF
GMREVEKYGIREVMRMALERIDPNGERSLHVSYDIDSLDVLEAPSTGTSVRGGLTLREGI
YIMEEAYGTGRLAAVDLVEVNPAIGTPEDVRRTVEAAIHLLVAACGHSRKG
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgttgccacggatagctttagcgaggctggtaggccgcaccggtgtcacgtttggagcg
tcaaccagcagctactgcacctccacggccgatcactcgtttgcgacgatcaaaccgaaa
aagatcaactacgaacgcattggaatcgtcggtgtaccgttcgacaagggccagcgcaag
aagggtgtcggtttgggtcccaaagcgatccgtgaagctggcctgatcgaccacatccag
gagatatcgcccaagctgaacattaaagattacggtgacatccagtatgaagcgctcaac
ttccagggccgtaaggtgggcaacatgaagaagctggagcacgtggccagctgtagcagg
aacttatcgcaccaggtgacggaggtgctggatgacgatcggttgtgcataacgctcggc
ggagatcacgcgatcgcgatcggatcgatcgatggtcatctgcaccacagcaaggatgtg
gccgtgatttgggtcgatgcacatgcggacctaaacaccaactcaacctccccgtccggg
aacattcacggtatgccggtggctttgcttgcccgcgagctgtgcgactactggccgtac
atccccggcatggactggcaggagccgatcatttcgatcaagaaccttgcgtacatcggg
ctgcggtcggtcgatccgtacgagcgggcaatcatcgagaagtttggcatcaacgcgttc
ggcatgcgggaggtggaaaagtacggcatacgggaggtgatgcgcatggcgctggaacgg
atcgatcccaacggtgagcggagtttgcacgtgagctacgacatcgattcgctggacgtg
ctggaagcaccgagcacgggcacaagcgtccggggtggactgacgctgcgcgaaggcatc
tacattatggaggaagcgtacgggacgggccggctggcggcggtcgatctggtggaggtg
aacccggccatcggcacaccggaggacgtgcggcgtacggtggaagcggccatacatcta
ctggtggcagcctgtggtcacagccgcaagggt

DBGET integrated database retrieval system