KEGG   Anopheles gambiae (mosquito): AgaP_AGAP008830Help
Entry
AgaP_AGAP008830   CDS       T01036                                 

Definition
AGAP008830-PA
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aga00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    AgaP_AGAP008830
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    AgaP_AGAP008830
Enzymes [BR:aga01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     AgaP_AGAP008830
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3R
AA seq 913 aa AA seqDB search
MSDFKQQVAAVPQYGLKLKFNHVFSDTRNQNLRPSFRQILSMVPLALRYIPYYWKVAREG
RQVLMDYWYTENGKQIYGAPLGGIGAGTIGRGFAGEFCRYQLKPGLYEYNTVHANQFIVT
IKDETGATIFHSLLSTYRSYVQKIDSHRLAKAFVLRVWAGFISYRPKTPLASWESGLDAS
RCSYTALYPRAWSEYDLSEHGVKLVQRQISPIIPHDYKESSLPCAVFVWTVENVCDKDRQ
VTLTFTFKNGTGTKKQDAEGGSETSAFTQGNARGVSIRQTIAEMPCTYCVSCRSSSEINL
TRCERFDPTGNGEKLWNDLKENGHLTEKSNDETLKSKDVAVAVSGQILVQPGTTSQLEFA
LVWDMPKVHFQKRGKEYHRYYTKYFGKSGDAGPQISDYALNNYGKWERLIDEWQRPILED
ADLPDWYKSAIFNELYFIADGGSVWFTMDDQTDLPFDDPRLAYGRYSYLEGHEYRMYTTY
DVHFYASHALASLWPNLQVSIQYDYKDSIEREITEGRKHLYDGKVIPRKIKNSVPHDLGD
PAEEPFDLINAYPIHDVSEWRDLNLKFILQVYRDYYTLNHYAQLNAENASKFSSIEFIDK
ESMYDTYIQDNRNRPNGAGSPIDSNQKAANRKSASMYINETNGKVYLMDALTYLKAMYPA
CRVVLEHSLEWDKDGDGLIENSKAPDQTYDTWVMDGPSAYCGGLWLASLHCMSAMASLLD
QNEDSDRYKAVLDKGRASFEEKLWNGTYYRFDAQSASKNSIMSDQLCGHWYLRSCGFDYD
VFPKENVRLAMRTIYENNVMRFCGGQLGAVNGYVPSGQPNKDGRPDTVSIQGEEVWTGVT
YALASTMIHEGMFEEAFKTAGGLYQALSERIGMNFETPEAVYAERHYRAIGYMRPLSIWS
MQTAWEMKKLRRD
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atgagcgactttaaacaacaagtggccgccgtgccgcagtacggcttaaagctcaagttc
aaccatgtctttagcgacacccgcaaccaaaacttgcgcccctcgttccggcagatcctt
tccatggtaccgctggcgttgagatacattccctactactggaaggtggcgcgcgagggc
cgccaggtgctgatggactactggtacacggagaacggcaagcagatctacggcgcaccg
ctcggcggcattggcgccggcacgatcgggcgcggattcgccggcgagttctgccgctac
cagctgaagccgggcctgtacgagtacaacaccgtgcacgccaatcagttcatcgtaacg
attaaggacgaaactggcgccaccatattccacagtctgctgtcgacctacaggtcctac
gtgcagaaaatcgattcccatcgtctggcgaaggcttttgtcttgcgggtttgggctggt
tttatttcctaccggcccaagactccgctcgccagctgggaaagtgggctggatgcgtcc
cggtgcagctacaccgcactgtacccccgtgcctggtccgagtacgatctgagcgagcac
ggcgtaaagctggtgcagcgccagatctcgccgatcatcccgcacgactacaaggaaagc
tcgctaccgtgcgccgtgttcgtctggacggtcgagaacgtgtgcgacaaggaccggcag
gtgacgctcacgttcacgttcaagaacggaaccggcacgaagaagcaggatgcagagggt
ggcagtgagacgagtgcgttcacgcaggggaatgcacggggcgtctcgatacggcagacg
atcgccgagatgccgtgtacgtactgtgtgagctgccgcagctcgtccgagatcaatctg
acgcggtgcgagcggttcgacccgaccggcaatggggagaagctgtggaacgatctgaag
gagaacggccatctgacggagaagtccaacgatgagacgctcaagtccaaggacgtcgct
gttgccgttagtgggcagatattagtgcaacccggcaccacatcgcagctagagtttgca
ctcgtgtgggacatgccgaaggtacatttccagaagcgcggcaaggaataccatcgctac
tatacgaagtacttcggcaagagcggtgacgcaggaccgcaaatctcggactacgcgctc
aacaattacggcaagtgggagcgattgatcgacgagtggcagcgaccaatactggaagat
gcagatctcccggattggtacaagagtgcaatctttaacgagctgtacttcattgcggac
ggtggcagcgtgtggttcacgatggacgatcagaccgatctgccgtttgacgatcctcgg
ctggcgtatgggcgttactcgtacctggagggtcacgagtatcgcatgtacacgacgtac
gatgtgcacttctacgcgtcgcacgcactggccagtctgtggccaaatctgcaggttagc
atccaatacgactacaaggacagtatagagcgcgaaattaccgaaggacggaagcatctg
tacgatggcaaggtgattccgagaaagattaaaaactccgtaccgcacgatcttggtgat
cctgcggaagaaccgttcgatctgatcaacgcgtaccccatccacgacgtgtcggagtgg
cgtgacctgaacctaaagttcatcctgcaggtgtaccgcgactactacacactcaaccac
tacgcccagctaaacgcggaaaacgcaagcaagttcagctcgatcgagttcatcgacaag
gagagcatgtacgacacgtacatacaggacaatcgcaaccggccgaacggggccggctca
ccgatcgacagcaaccagaaggccgccaaccgcaaatcggcctcgatgtacatcaacgaa
acgaacggcaaggtgtatctgatggatgcgctcacctacctgaaggcgatgtatcccgcc
tgccgcgtggtgctggaacattcgctcgagtgggacaaggacggggacgggctgatcgag
aacagcaaagcgcccgaccaaacgtacgacacgtgggtgatggatgggccgagcgcgtac
tgcggtgggctgtggctggccagtctgcactgcatgtcggcgatggccagcctgctggat
cagaacgaggatagcgaccggtacaaggcggtcctggacaagggacgtgcttcgttcgaa
gaaaagctgtggaacggcacgtactatcggttcgatgcgcagagtgcgtcgaagaatagc
atcatgtcggatcagctgtgcggccactggtatctgcgctcgtgcgggttcgattacgac
gttttcccgaaggaaaacgtacggttagcgatgcgcacgatctacgagaacaacgtgatg
cggttctgtggcggacagctcggtgcggtcaatgggtacgtgccgagcgggcagccgaac
aaggatggccgcccggacactgtgtccatacagggggaggaggtgtggacgggcgtgacg
tacgcgctcgcatcgaccatgattcacgagggcatgtttgaggaagcgttcaagacggcg
ggtggactgtaccaggcgctgtcggagcgcatcggtatgaactttgagacaccggaggcg
gtgtacgcggaaaggcactatcgggcgatcggttacatgcgcccgcttagcatatggtcc
atgcagacggcttgggagatgaagaagctgcgccgcgattaa

DBGET integrated database retrieval system