KEGG   Anopheles gambiae (mosquito): AgaP_AGAP008863Help
Entry
AgaP_AGAP008863   CDS       T01036                                 

Definition
AGAP008863-PA
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
aga  Anopheles gambiae (mosquito)
Brite
Enzymes [BR:aga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     AgaP_AGAP008863
Protein kinases [BR:aga01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   AgaP_AGAP008863
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3R
AA seq 930 aa AA seqDB search
MRITHHPGRAIDASLSLEQRSAMGALYEANWNKVQSSMNSLIESHHETSPYDTVGQAASS
RPVSQPAPSYRISTVTGSSEDDEGLPDEEERDAFQESSGALKALNGYRPATIRRARQRQY
PEWDELKDPKDAPDDPSATKYHTVRGGRMFENTHKPRPALRGSSMAEFDAGHYANLLPGE
DRAPAVPARNGTLKRSNTVAAQIPTAQQRTLDRRELFLRQQQHQYTPPQQPSKKERVRQQ
KPIDDNLSIGDRMTSYRSDNDLCSQIYREGSRNGSLASIPRATATLSRNRTIKGRPILED
IPADLLPRLEPEKPKRSSSKKVGFGKIGGKYPSLVPVHTYARKRRTGNLIANEPIYGNVE
EIYANPDGESPQYLLQQSIKRFFIHRVSVQTVSFFPLRGAFSVQGRVEVSREGKYLSTLS
GAKVLGELAILYHCQRTATITAATDCKLWAIERQCFQTIMMRTGLIRQAEYSDFLKSVPI
FKNLPEDTLCKISDVLEECYYQKGDYIIRQGARGDTFFIISKGQVRVTIRQPDTQEEKFI
RTLGKGDFFGEKALQGDDLRTANIICDSPEGVTCLVIDRDTFNQLISNLDEIRNRYNDEG
VSQRKKIWEEFREVKLSDLRVISTLGVGGFGRVELVQLAQDKSRSFALKQMKKAQIVETR
QQQHIMSEKEIMSEANSDFIVKLYKTFKDRKYLYMLMESCLGGELWTILRDRGHFDDGTT
RFYTACVVEAFDYLHSRNIIYRDLKPENLLLDVSGYVKLVDFGFAKKLQSGRKTWTFCGT
PEYVAPEVILNRGHDISADYWSLGVLMFELLTGTPPFTGADPMRTYNIILKGIDAIEFPR
NITRNASALIKKLCRDNPTERLGYQRGGISEIQKHKWFDGFYWEGLRNRSLPPPILPKVQ
SVVDTANFDDYPADPDGPPPDDLSGWDDDF
NT seq 2793 nt NT seq  +upstreamnt  +downstreamnt
atgaggatcacccatcatccgggccgtgcgattgacgcgagtctttcgctggagcagcgc
agtgcgatgggtgccctgtacgaggctaactggaacaaggtacagtccagcatgaactca
ctgatcgagagtcatcatgagacgagtccgtatgacacagtaggtcaggcagcgagtagc
agaccggtcagccagcctgcgccatcctatcgcatctcaacagtgaccggatcttccgaa
gatgatgaaggcctgccggacgaggaggagcgtgacgcatttcaggagagcagtggcgca
ctgaaggccctaaatgggtaccgtccagccacgataagacgcgcccgccagcgacagtac
ccagagtgggacgagttgaaagatccgaaagatgctccggatgatccaagcgccaccaaa
tatcataccgttcgtgggggacggatgtttgaaaatactcacaaacctcgaccagccttg
cgggggtccagcatggcagagtttgatgcggggcactatgcaaacttgctcccaggggaa
gaccgtgctcccgccgtaccggcacgcaacggaacgctaaaacgttccaacacggtggcg
gcccaaattccaaccgcccagcagcgaacgctcgatcgacgggagctgtttctgcgccag
cagcaacaccagtacactcctccacagcaaccctcgaagaaggagcgcgtacggcagcag
aaaccgatcgacgacaatctctcgatcggcgatcgtatgacatcgtaccggtcggataac
gatctctgctcgcaaatctatcgcgagggcagccgaaacgggtcgctcgcaagtataccg
cgtgcaactgcgacactatcccgcaatcgcacgatcaaaggccggcctatcctggaagac
ataccggcggatctgttgccccggctggaaccggaaaagccgaaacgctcctccagcaag
aaggttgggtttggtaagatcggcgggaagtatccctcgctggttccggtgcatacgtac
gcacggaagcgtcgcacgggcaatctgatcgccaacgagcccatctacggcaacgtggag
gagatctacgccaatcctgacggtgaaagcccccagtatttgcttcagcaatcaatcaaa
cggtttttcattcatcgcgtttcggttcaaacagtgtctttctttccgcttcgcggagct
ttcagcgtccagggccgcgtcgaagtgtcgcgcgaaggcaaatacctgtccacgctgtcc
ggtgcgaaggtgctcggcgagctagccatcctgtatcactgccagcgaacggccaccatc
accgccgccaccgactgcaagctgtgggcgatcgagcgacaatgcttccagacgatcatg
atgcgcaccgggctgatacggcaggccgagtactccgatttcctcaagagtgtgccgatc
ttcaaaaacctcccggaggacacgctgtgcaaaatatcggacgtgctggaggagtgctac
taccagaagggtgactacatcatccgccagggtgcccgcggcgacacgttcttcatcatc
tcgaagggtcaggtgcgcgtcacgatacgccagccggacacgcaggaggagaagttcatc
cgcacgctcgggaagggtgatttcttcggcgagaaggcactgcaaggcgatgatctacgc
acggcaaacattatctgtgactcaccggaaggcgtcacctgcctggtgattgaccgtgac
acgttcaaccagctgatctcgaacctggacgaaatccgaaaccgctacaacgatgagggt
gttagccagcggaagaagatttgggaagagttccgagaggtgaagctgtccgatctgcgc
gtcatctcgacgctcggcgtcggtggctttgggcgggtggagctggtccagctggcccag
gacaagtcgcgctcgttcgcgctgaaacagatgaagaaggcacagatcgtggagacgcgc
cagcagcagcacatcatgtcggagaaggagatcatgagcgaggcgaacagtgactttatc
gtgaagctgtacaaaacgttcaaggaccgcaagtacctgtacatgctgatggaaagctgc
ctgggcggggagctgtggacgatcttgcgcgatcgtggccacttcgatgatggcactacg
cgcttttacacggcttgcgtggtggaggcgttcgattatctgcactcgcgcaacattatc
tatcgcgatctgaagccggagaatctgctgctggatgtgtcggggtacgtgaagctggtg
gactttggattcgctaagaagctgcaatcaggtcgcaaaacatggacgttctgcggtacg
ccggagtacgtagcgccggaagttattcttaaccgtggccatgacatcagtgccgactat
tggtcgcttggagtgctcatgtttgagctgctgaccggtacgccaccgttcactggagcc
gatccgatgcgcacgtacaacatcatcctgaagggtatcgatgcgatcgagttcccgcgc
aacatcacccgcaatgccagtgcgctgatcaagaagctgtgccgggacaatccgaccgag
cgtctcggctaccagcgaggcggcatcagtgaaatccaaaagcacaaatggttcgatggc
ttctactgggaaggattgcggaatcgttcactgccgccgccgatcctaccgaaagtacag
agcgtcgtcgatacggccaactttgatgactatccggccgatccggatggtcctccgccg
gatgatctgtccggatgggacgatgatttctaa

DBGET integrated database retrieval system