KEGG   Anopheles gambiae (mosquito): AgaP_AGAP008990Help
Entry
AgaP_AGAP008990   CDS       T01036                                 

Definition
AGAP008990-PA
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Glycerophospholipid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:aga00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    AgaP_AGAP008990
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    AgaP_AGAP008990
Enzymes [BR:aga01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     AgaP_AGAP008990
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3R
AA seq 376 aa AA seqDB search
VPGDGGSQMDAIIDKPNKVSILCQKHTTTFFNLWLNKELLLPLVIDCWIDNIRLEYDNVT
RTTCNSPGVTTRVPGFGQSETVEWIDPSHASVGAYFVNIANALVSNGYVRDKSIVGAPYD
FRKGPTENKEYFLQLKFLVEQTYTINHDTPVTFIVHSMGAPMTLHFLQLQTAQWKAKYIK
RVISLAGAWAGSVKALKVYAIGDDLGAFALSGKVMRAEQITNPSLAWLLPSPLFWKPNEV
LARTQSRVYTMAQMEEFFEDLEYPNGWEMRKDSLPYTLNFTAPGVELHCLYGSKINTVES
LDYQKSYDLSGTPVLKMGNGDGTVNSRSLEACLQWTTQQKQTIVAKEFPGADHMSILADV
NVIDNIVKLLLSDVAN
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
gtacccggagatggcggtagccagatggatgcaatcatcgacaaaccgaacaaggtttcg
atcctgtgccagaaacacaccaccacgttctttaacctttggctgaacaaggaactgctg
cttcccctagtgatcgactgctggatcgacaacattcgcctcgagtacgacaatgtaacg
cgcaccacgtgcaactcgcccggcgttacgacgcgcgtgccaggcttcggtcagtcggaa
acggtcgaatggatcgatccgtcgcacgcgtcggtcggtgcgtactttgtcaacatcgcc
aacgcgctcgtttcgaacgggtacgtgcgggacaaatcgatcgttggcgcaccgtacgac
tttcgcaagggaccgaccgaaaataaagagtatttcctgcagctcaaatttttggtcgag
cagacgtacaccattaaccacgacacaccggtcacctttatcgtgcacagcatgggcgcc
cctatgacactgcacttcctgcagctacaaacggcccagtggaaggcaaagtacataaag
cgcgtcatttcgcttgccggtgcttgggcgggcagcgtgaaagccttgaaggtgtacgca
atcggcgatgatctcggtgcgtttgcgctgagcggtaaggtgatgcgtgccgagcagatc
accaacccgtcgctggcctggctgctcccatcgccactgttctggaagccgaacgaggtg
ctcgcacggacccagtcgcgcgtatacacgatggcacagatggaagagtttttcgaggat
ctggagtacccgaatgggtgggaaatgcgcaaagattccctgccgtacacgcttaacttt
accgcacccggtgtggagctgcactgtctgtacggtagcaaaatcaacactgttgaatcc
ttggattatcagaaatcgtacgatctgagcggcacaccagtccttaagatgggcaatggc
gacggtacggtcaattctcgctcgctggaagcttgcctgcagtggacaacgcaacagaag
caaacgatcgttgccaaagagttcccaggggccgatcacatgagcattctggcggatgtg
aacgttatcgataacatcgtgaagctgctcctgtcggacgttgctaactga

DBGET integrated database retrieval system