KEGG   Anopheles gambiae (mosquito): AgaP_AGAP009039Help
Entry
AgaP_AGAP009039   CDS       T01036                                 

Definition
AGAP009039-PA
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aga00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AgaP_AGAP009039
Enzymes [BR:aga01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     AgaP_AGAP009039
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3R
AA seq 259 aa AA seqDB search
KLAVFDGKKAIRGGIPFVFPQFGPWNFGPQHGFGRVVRWTLERAPERLPSGDVEAVFSLM
DNEITRSMWNYPFRITYRLILREKELHFHIGVYNPSKDMTFSFNLLLHTYLKVPDVRRCQ
ITGLHGCTFVDKTRDGAIYQEGRDAVTINEWTDRVYQHTPQEHIITNVVSGRKMRLQKYN
FPDTVVWNPWMEKARECQDFGDDEYPNMICVEAGHVSTPVILLPGTAFEASQILQVLWSP
TPSSGSFTNALFLRLCFLL
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
aaactagcagtttttgatgggaagaaggcaatccgtggtggcataccgttcgtttttcca
caattcggtccctggaactttggcccacagcatggcttcggccgggtggtccggtggacg
ctcgagcgtgccccggaacgattgcccagcggtgacgtggaagccgtcttcagcctaatg
gacaacgaaattacacgctcgatgtggaactatccatttcgcataacgtaccggttgatt
ctgcgcgagaaggagctccacttccacatcggcgtgtacaacccgagcaaagacatgacc
ttctccttcaatctgctgctgcacacctacctgaaggtgccggacgtgcgccggtgccag
attacgggactgcacggttgcacctttgtcgataagacacgagacggagccatctaccag
gagggccgggatgcggtcaccatcaacgagtggacggaccgggtctaccagcacacgccc
caggagcacatcatcacgaacgtggtgtccgggcggaagatgcgcctgcagaagtacaac
ttccccgacacggtcgtgtggaacccgtggatggagaaggcgcgcgagtgccaggacttt
ggtgacgacgagtacccgaacatgatctgcgtcgaggcgggccacgtctcgacaccggtc
atcctgctgcccggcaccgcgtttgaggcgtcacagatacttcaggtactatggtcccca
acaccatcttcgggatcttttactaacgccctgtttctgcggttgtgttttcttttgtag

DBGET integrated database retrieval system