KEGG   Anopheles gambiae (mosquito): AgaP_AGAP009039Help
Entry
AgaP_AGAP009039   CDS       T01036                                 

Definition
AGAP009039-PA
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:aga00010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3R
AA seq 259 aa AA seqDB search
KLAVFDGKKAIRGGIPFVFPQFGPWNFGPQHGFGRVVRWTLERAPERLPSGDVEAVFSLM
DNEITRSMWNYPFRITYRLILREKELHFHIGVYNPSKDMTFSFNLLLHTYLKVPDVRRCQ
ITGLHGCTFVDKTRDGAIYQEGRDAVTINEWTDRVYQHTPQEHIITNVVSGRKMRLQKYN
FPDTVVWNPWMEKARECQDFGDDEYPNMICVEAGHVSTPVILLPGTAFEASQILQVLWSP
TPSSGSFTNALFLRLCFLL
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
aaactagcagtttttgatgggaagaaggcaatccgtggtggcataccgttcgtttttcca
caattcggtccctggaactttggcccacagcatggcttcggccgggtggtccggtggacg
ctcgagcgtgccccggaacgattgcccagcggtgacgtggaagccgtcttcagcctaatg
gacaacgaaattacacgctcgatgtggaactatccatttcgcataacgtaccggttgatt
ctgcgcgagaaggagctccacttccacatcggcgtgtacaacccgagcaaagacatgacc
ttctccttcaatctgctgctgcacacctacctgaaggtgccggacgtgcgccggtgccag
attacgggactgcacggttgcacctttgtcgataagacacgagacggagccatctaccag
gagggccgggatgcggtcaccatcaacgagtggacggaccgggtctaccagcacacgccc
caggagcacatcatcacgaacgtggtgtccgggcggaagatgcgcctgcagaagtacaac
ttccccgacacggtcgtgtggaacccgtggatggagaaggcgcgcgagtgccaggacttt
ggtgacgacgagtacccgaacatgatctgcgtcgaggcgggccacgtctcgacaccggtc
atcctgctgcccggcaccgcgtttgaggcgtcacagatacttcaggtactatggtcccca
acaccatcttcgggatcttttactaacgccctgtttctgcggttgtgttttcttttgtag

DBGET integrated database retrieval system