KEGG   Anopheles gambiae (mosquito): AgaP_AGAP009100Help
Entry
AgaP_AGAP009100   CDS       T01036                                 

Definition
AGAP009100-PA
Orthology
K05619  
transglutaminase 1 [EC:2.3.2.13]
Organism
aga  Anopheles gambiae (mosquito)
Brite
Enzymes [BR:aga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     AgaP_AGAP009100
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3R
AA seq 734 aa AA seqDB search
QTDSPSADVLTVKSVDLCTEENGKDHHTKRYELMSRDEYSGKIPKLVVRRGQPFRLRLVC
DRPYDRARDALSLIFTVADEDQPTHGHGTLVGIPVNQFPEQLGEPEEWGAAIEAINGDLL
QVLVKPAATAPVGQWKLDIDTKLLSEAFGKSYSLPQAFYVLFNPWCPDDLVYMEEKAHRH
EYVMSDTTLIYRGSYNRLRPSVWKFGQFEKHVLDCSLLLIAKIGKVSATHRGDPVRVCRA
ISAAVNSPDDDGALMGNWSGDFSGGTPPTKWVGSVEILQQFYKRQKPVKFAQCWVFAGVV
STICRAIGIPSRVVTNYSSAHDTQASLTVDYFVDKSGKIMEEMNADSIWNYHVWNEVWMQ
RPDLGISSDGDYGGWQAIDATPQESSDGMFRCGPASVLAVKLGEVLKPYDNNFLFAEVNA
DKVFWRYTGPHHPLKLLRKDVLGIGLFISTKAVGRWEREDITSSYKFAEKSEEERATMLK
ALKQANSYFSRYYLNEEFNEVYFNFELRDDIKIGEPFSVILTVKNRSSENRHVVEGSLHV
DTVLYTGKDRESVKVDKFSVTLEPGTEESIRMIVEFHEYYRKLRDQAAFNISCMATVLDT
EFEFYAQDDFRVRKPDIKITLLGKPVSQAPVDVQFTLENPLPIPLHKGLFHLEGSGIGKP
LLFKHAEIAPGEKVSNTFTMTPPYSGRLTLAAKFTSKELDDVDGFLAFLAHPRPEDIITE
VEDNVIVARTDVID
NT seq 2205 nt NT seq  +upstreamnt  +downstreamnt
caaacagattcaccctccgctgatgtgctgacggtaaagtcggtcgatctttgcacggag
gaaaacggtaaagatcatcacaccaagcgatatgagctgatgagccgggatgagtatagt
gggaagataccgaagctggtcgtacgtcgtggacaaccgttccgtttgcggctggtatgc
gatcgtccgtacgatcgggctcgcgatgcgttgagccttatattcaccgtagctgatgag
gatcagccaacgcacggtcacgggacgttggtgggcattccggttaatcagttcccggag
cagcttggcgaaccggaggagtggggtgccgcgatcgaagcgatcaatggtgatctgctc
caggtgttggtgaagccggcagcgacggctccggtcggtcagtggaagctggacattgat
acgaagctgctgagtgaagcgttcggtaagagttattcgcttccgcaggcgttctacgtc
ctattcaatccatggtgtccggatgatctcgtgtacatggaagagaaagcacaccgtcac
gagtatgtgatgagtgacacgacactcatctaccgtggatcttacaatcgactacgcccc
tcggtgtggaagttcggacagtttgaaaagcacgtcctggattgttctctactgctgatt
gcaaagatcggcaaggttagtgcaacgcaccggggcgatccggtcagggtgtgtcgtgcc
atctcggccgcagtcaactcaccggacgacgatggtgcactgatgggcaactggagtgga
gacttctcgggtggaactccaccgaccaagtgggttggatcggtggagatactgcagcag
ttttacaagcgacagaagccggtcaagtttgcccagtgctgggtgtttgcgggtgttgtg
tctacaatttgtcgtgccatcggtataccgtcccgtgtcgtaacgaactactcctcagcg
cacgacacgcaagcctccctcacggtggactacttcgtggacaagagtggcaaaattatg
gaggagatgaacgccgactccatctggaactatcacgtgtggaatgaggtgtggatgcag
cggcccgatctgggcatcagctcagacggtgactatggtggctggcaagcgatcgatgca
acgccccaggaaagctcggacggaatgttccgctgtggtcccgcgtccgtgttggcggtg
aagctaggtgaagtgctcaaaccgtacgataataacttcctctttgcggaggttaatgcg
gacaaggtgttttggcgctacaccgggccacaccatccgctgaagttgctgcgcaaggat
gtgcttggaattgggctgtttatcagcacgaaggcagtcggacggtgggagcgggaggac
attacgtcaagctacaagtttgcagaaaagtcggaagaagaacgggccacaatgctgaag
gcgctgaagcaagctaacagctactttagccgctactatctgaacgaggagttcaatgag
gtttactttaactttgaactgcgggatgatattaagatcggtgaaccgttcagtgtgata
ttgacggtcaaaaatcgatcatcggaaaaccggcacgtggtagagggatcgcttcacgtc
gataccgtactgtacacgggcaaagatcgggaaagcgtaaaggtggacaagttctccgtc
acactagaacctggcacggaagagtccattcgtatgatcgttgagttccacgagtactat
cgcaagctgcgcgatcaggcagcattcaacatctcctgtatggcgaccgtactcgatacg
gagtttgagttctacgcgcaggatgatttccgtgtgcgcaagccggatataaagataacg
ctgcttggcaagccagtatcgcaggcacctgttgatgtgcagtttacgcttgaaaatccg
ctcccgataccgctgcacaagggactgttccatctggaaggatcgggcattggcaaaccg
cttctttttaagcacgctgaaattgcacccggagagaaggtctccaacacgttcactatg
acaccaccgtactcgggacggttgacgctcgctgccaagtttacctcgaaagagctggac
gatgtggatggctttttggcgttcctcgcccatccacgaccggaagatatcatcacggag
gtggaagataacgtaatcgttgcccggacggacgtgatcgattag

  All links  
No link information was found.   
DBGET integrated database retrieval system