KEGG   Anopheles gambiae (mosquito): AgaP_AGAP009207Help
Entry
AgaP_AGAP009207   CDS       T01036                                 

Definition
AGAP009207-PA
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
mTOR signaling pathway
Dorso-ventral axis formation
TGF-beta signaling pathway
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway - fly [PATH:aga04013]
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:aga04350]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:aga04068]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:aga04150]
Organismal Systems; Development; Dorso-ventral axis formation [PATH:aga04320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3R
AA seq 331 aa AA seqDB search
FSFCLFSIRSSAVDTVTKTKVAIKKISPFEHQTYCQRTLREIKILTRFKHENIIDIRDIL
RVPSIEQMKDVYIVQCLMETDLYKLLKTQRLSNDHICYFLYQILRGLKYIHSANVLHRDL
KPSNLLLNTTCDLKICDFGLARVADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSID
IWSVGCILAEMLSNRPIFPGKHYLDQLNHILGVLGSPSQEDLECIINEKARSYLQSLPYK
PKVPWSRLFPNADQNALDLLGKMLTFNPHNRISVEDALAHPYLEQYYDPADEPVAEEPFR
IAMELDDLPKETLKQLIFEETLRFNHNDPPV
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
ttttctttttgcttgttttcaattcgcagctctgcagtggacaccgtcaccaagaccaaa
gttgccatcaagaaaatatctcccttcgagcatcagacctactgtcagcgaacattgcgg
gaaatcaaaattcttaccagattcaaacacgaaaacatcatagacataagagatatcctc
cgggtgcctagtatagagcagatgaaagatgtatatattgttcagtgcttaatggagact
gatctatacaaactactaaaaacacagcgactaagcaatgatcatatctgctatttcctg
tatcaaatacttcgtggcctgaagtacatccactcggcaaacgtgctgcacagggatctg
aagcccagcaatctgctgctgaatacgacttgtgatttaaagatttgtgatttcggtctt
gcacgcgtagccgatcccgagcacgatcacaccggcttcctgacggagtacgtggccacc
agatggtaccgggcgccagaaatcatgctcaattccaagggctacacaaaatcgatcgac
atctggtcggtcggctgcatactggcggagatgctgagcaaccggcccatcttccccggc
aaacactatctcgatcagctgaaccacatcctgggcgtgctgggctccccgtcccaggag
gatctggagtgcatcatcaacgagaaggcgcgcagctacctgcagtcgctgccgtacaag
ccgaaggtcccgtggtcgcgcctcttccccaacgccgaccagaatgcgctcgatctgctc
ggcaagatgctcacgttcaatccgcacaatcgcatctcggtcgaggacgcgctggcccat
ccctacctggagcagtactacgatccggcggacgagcccgtggccgaggaaccgttccgt
atcgcgatggagctggacgatctgccgaaggaaacgctgaaacaattaatcttcgaggaa
acgctgcgcttcaaccacaacgatccgccagtataa

DBGET integrated database retrieval system