KEGG   Anopheles gambiae (mosquito): AgaP_AGAP009207Help
Entry
AgaP_AGAP009207   CDS       T01036                                 

Definition
AGAP009207-PA
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
MAPK signaling pathway - fly
FoxO signaling pathway
mTOR signaling pathway
Dorso-ventral axis formation
TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:aga00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    AgaP_AGAP009207
   04350 TGF-beta signaling pathway
    AgaP_AGAP009207
   04068 FoxO signaling pathway
    AgaP_AGAP009207
   04150 mTOR signaling pathway
    AgaP_AGAP009207
 Organismal Systems
  Development
   04320 Dorso-ventral axis formation
    AgaP_AGAP009207
Enzymes [BR:aga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     AgaP_AGAP009207
Protein kinases [BR:aga01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   AgaP_AGAP009207
Exosome [BR:aga04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   AgaP_AGAP009207
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3R
AA seq 331 aa AA seqDB search
FSFCLFSIRSSAVDTVTKTKVAIKKISPFEHQTYCQRTLREIKILTRFKHENIIDIRDIL
RVPSIEQMKDVYIVQCLMETDLYKLLKTQRLSNDHICYFLYQILRGLKYIHSANVLHRDL
KPSNLLLNTTCDLKICDFGLARVADPEHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSID
IWSVGCILAEMLSNRPIFPGKHYLDQLNHILGVLGSPSQEDLECIINEKARSYLQSLPYK
PKVPWSRLFPNADQNALDLLGKMLTFNPHNRISVEDALAHPYLEQYYDPADEPVAEEPFR
IAMELDDLPKETLKQLIFEETLRFNHNDPPV
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
ttttctttttgcttgttttcaattcgcagctctgcagtggacaccgtcaccaagaccaaa
gttgccatcaagaaaatatctcccttcgagcatcagacctactgtcagcgaacattgcgg
gaaatcaaaattcttaccagattcaaacacgaaaacatcatagacataagagatatcctc
cgggtgcctagtatagagcagatgaaagatgtatatattgttcagtgcttaatggagact
gatctatacaaactactaaaaacacagcgactaagcaatgatcatatctgctatttcctg
tatcaaatacttcgtggcctgaagtacatccactcggcaaacgtgctgcacagggatctg
aagcccagcaatctgctgctgaatacgacttgtgatttaaagatttgtgatttcggtctt
gcacgcgtagccgatcccgagcacgatcacaccggcttcctgacggagtacgtggccacc
agatggtaccgggcgccagaaatcatgctcaattccaagggctacacaaaatcgatcgac
atctggtcggtcggctgcatactggcggagatgctgagcaaccggcccatcttccccggc
aaacactatctcgatcagctgaaccacatcctgggcgtgctgggctccccgtcccaggag
gatctggagtgcatcatcaacgagaaggcgcgcagctacctgcagtcgctgccgtacaag
ccgaaggtcccgtggtcgcgcctcttccccaacgccgaccagaatgcgctcgatctgctc
ggcaagatgctcacgttcaatccgcacaatcgcatctcggtcgaggacgcgctggcccat
ccctacctggagcagtactacgatccggcggacgagcccgtggccgaggaaccgttccgt
atcgcgatggagctggacgatctgccgaaggaaacgctgaaacaattaatcttcgaggaa
acgctgcgcttcaaccacaacgatccgccagtataa

  All links  
No link information was found.   
DBGET integrated database retrieval system