KEGG   Anopheles gambiae (mosquito): AgaP_AGAP009461Help
Entry
AgaP_AGAP009461   CDS       T01036                                 

Definition
AGAP009461-PA
Orthology
K04440  
c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
FoxO signaling pathway
Protein processing in endoplasmic reticulum
Wnt signaling pathway
Hippo signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:aga00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    AgaP_AGAP009461
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    AgaP_AGAP009461
   04391 Hippo signaling pathway -fly
    AgaP_AGAP009461
   04068 FoxO signaling pathway
    AgaP_AGAP009461
Enzymes [BR:aga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     AgaP_AGAP009461
Protein kinases [BR:aga01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   AgaP_AGAP009461
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3R
AA seq 375 aa AA seqDB search
MSSRHAFYTVEVGDTKFTILKRYQNLKPIGSGAQGIVCAAYDTVTQQNVAIKKLSRPFQN
VTHAKRAYREFKLMKLVNHKNIIGLLNAFTPQRTLEEFQDVYLVMELMDANLCQVIQMDL
DHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTTFMMT
PYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLGT
PSQNFMTRLQPTVRNYVENRPRYSGYAFDRLFPDVLFPTDSNEHNRLKASQARDLLSRML
VVDPEHRISVDQALVHSYINVWFDESEVNAPAPGPYDHSVDEREHTVEQWKELIYQEVME
YEARNNLADGEGAPR
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgagctcgcgtcacgccttctacaccgtcgaggtgggcgacaccaagtttaccattcta
aagcgataccaaaacctgaaaccgatcggttccggtgctcaaggcattgtatgtgccgca
tacgatacagtaacacagcagaacgttgccatcaaaaagctatccagacctttccaaaat
gtcactcacgccaaacgagcctacagggagtttaagcttatgaaattagtcaatcataaa
aatatcattggactgctgaacgcgttcacgccccagcgcacactagaagagttccaggat
gtgtacctggtcatggagcttatggatgcgaacctctgccaggtcatacagatggatctg
gaccacgagcggatgtcctacctgctctaccagatgctgtgcggcatcaagcatctccac
tcggcgggaattattcaccgggacttgaagccctccaacattgtggtaaagtcggactgc
acactgaaaatcctcgactttgggctggcccgtacggccggcaccaccttcatgatgacg
ccgtacgtcgtcacgcggtactaccgtgcgccggaggtcatcctcgggatgggatacaaa
gagaacgtcgacatctggtcggtcggctgcatcatgggggagatgatacgcggcggcgtc
ctgttccccggtacagatcatattgatcagtggaataaaatcattgaacaattgggtact
ccgtcccagaactttatgacgcggttgcaaccgaccgtgcggaactacgtggagaacagg
ccccgctactcggggtacgcgttcgatcggctcttcccggacgtgctgtttccgaccgac
tcgaacgagcacaaccgactgaaggctagtcaggcgcgggatctgctcagcaggatgctg
gtggtcgatccggagcatcgcatctcggtcgaccaggcgctggtgcacagctacatcaac
gtgtggttcgacgagagcgaagtgaatgcgcccgcacccggcccgtacgatcacagcgtg
gacgagcgcgagcacacggtcgagcagtggaaggagctgatctaccaggaggtgatggag
tacgaggcgcgcaataatctggcggacggggagggcgctccacggtag

DBGET integrated database retrieval system