KEGG   Anopheles gambiae (mosquito): AgaP_AGAP009461Help
Entry
AgaP_AGAP009461   CDS       T01036                                 

Definition
(RefSeq) AGAP009461-PA
  KO
K04440  mitogen-activated protein kinase 8/9/10 (c-Jun N-terminal kinase) [EC:2.7.11.24]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
aga04013  MAPK signaling pathway - fly
aga04068  FoxO signaling pathway
aga04137  Mitophagy - animal
aga04140  Autophagy - animal
aga04141  Protein processing in endoplasmic reticulum
aga04214  Apoptosis - fly
aga04215  Apoptosis - multiple species
aga04310  Wnt signaling pathway
aga04391  Hippo signaling pathway - fly
aga04624  Toll and Imd signaling pathway
aga04933  AGE-RAGE signaling pathway in diabetic complications
Module
aga_M00688  MAPK (JNK) signaling
Brite
KEGG Orthology (KO) [BR:aga00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    AgaP_AGAP009461
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    AgaP_AGAP009461
   04310 Wnt signaling pathway
    AgaP_AGAP009461
   04391 Hippo signaling pathway -fly
    AgaP_AGAP009461
   04068 FoxO signaling pathway
    AgaP_AGAP009461
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    AgaP_AGAP009461
   04137 Mitophagy - animal
    AgaP_AGAP009461
  Cell growth and death
   04214 Apoptosis - fly
    AgaP_AGAP009461
   04215 Apoptosis - multiple species
    AgaP_AGAP009461
 Organismal Systems
  Immune system
   04624 Toll and Imd signaling pathway
    AgaP_AGAP009461
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    AgaP_AGAP009461
Enzymes [BR:aga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     AgaP_AGAP009461
Protein kinases [BR:aga01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   AgaP_AGAP009461
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like RIO1 APH Haspin_kinase FTA2
Motif
Other DBs
NCBI-GeneID: 1271440
NCBI-ProteinID: XP_310236
VectorBase: AGAP009461
UniProt: Q7QG32
Position
3R
AA seq 375 aa AA seqDB search
MSSRHAFYTVEVGDTKFTILKRYQNLKPIGSGAQGIVCAAYDTVTQQNVAIKKLSRPFQN
VTHAKRAYREFKLMKLVNHKNIIGLLNAFTPQRTLEEFQDVYLVMELMDANLCQVIQMDL
DHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTTFMMT
PYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLGT
PSQNFMTRLQPTVRNYVENRPRYSGYAFDRLFPDVLFPTDSNEHNRLKASQARDLLSRML
VVDPEHRISVDQALVHSYINVWFDESEVNAPAPGPYDHSVDEREHTVEQWKELIYQEVME
YEARNNLADGEGAPR
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgagctcgcgtcacgccttctacaccgtcgaggtgggcgacaccaagtttaccattcta
aagcgataccaaaacctgaaaccgatcggttccggtgctcaaggcattgtatgtgccgca
tacgatacagtaacacagcagaacgttgccatcaaaaagctatccagacctttccaaaat
gtcactcacgccaaacgagcctacagggagtttaagcttatgaaattagtcaatcataaa
aatatcattggactgctgaacgcgttcacgccccagcgcacactagaagagttccaggat
gtgtacctggtcatggagcttatggatgcgaacctctgccaggtcatacagatggatctg
gaccacgagcggatgtcctacctgctctaccagatgctgtgcggcatcaagcatctccac
tcggcgggaattattcaccgggacttgaagccctccaacattgtggtaaagtcggactgc
acactgaaaatcctcgactttgggctggcccgtacggccggcaccaccttcatgatgacg
ccgtacgtcgtcacgcggtactaccgtgcgccggaggtcatcctcgggatgggatacaaa
gagaacgtcgacatctggtcggtcggctgcatcatgggggagatgatacgcggcggcgtc
ctgttccccggtacagatcatattgatcagtggaataaaatcattgaacaattgggtact
ccgtcccagaactttatgacgcggttgcaaccgaccgtgcggaactacgtggagaacagg
ccccgctactcggggtacgcgttcgatcggctcttcccggacgtgctgtttccgaccgac
tcgaacgagcacaaccgactgaaggctagtcaggcgcgggatctgctcagcaggatgctg
gtggtcgatccggagcatcgcatctcggtcgaccaggcgctggtgcacagctacatcaac
gtgtggttcgacgagagcgaagtgaatgcgcccgcacccggcccgtacgatcacagcgtg
gacgagcgcgagcacacggtcgagcagtggaaggagctgatctaccaggaggtgatggag
tacgaggcgcgcaataatctggcggacggggagggcgctccacggtag

DBGET integrated database retrieval system