KEGG   Anopheles gambiae (mosquito): AgaP_AGAP009461Help
Entry
AgaP_AGAP009461   CDS       T01036                                 

Definition
AGAP009461-PA
Orthology
K04440  
c-Jun N-terminal kinase [EC:2.7.11.24]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
FoxO signaling pathway
Protein processing in endoplasmic reticulum
Wnt signaling pathway
Hippo signaling pathway - fly
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:aga04141]
Environmental Information Processing; Signal transduction; Wnt signaling pathway [PATH:aga04310]
Environmental Information Processing; Signal transduction; Hippo signaling pathway -fly [PATH:aga04391]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:aga04068]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3R
AA seq 375 aa AA seqDB search
MSSRHAFYTVEVGDTKFTILKRYQNLKPIGSGAQGIVCAAYDTVTQQNVAIKKLSRPFQN
VTHAKRAYREFKLMKLVNHKNIIGLLNAFTPQRTLEEFQDVYLVMELMDANLCQVIQMDL
DHERMSYLLYQMLCGIKHLHSAGIIHRDLKPSNIVVKSDCTLKILDFGLARTAGTTFMMT
PYVVTRYYRAPEVILGMGYKENVDIWSVGCIMGEMIRGGVLFPGTDHIDQWNKIIEQLGT
PSQNFMTRLQPTVRNYVENRPRYSGYAFDRLFPDVLFPTDSNEHNRLKASQARDLLSRML
VVDPEHRISVDQALVHSYINVWFDESEVNAPAPGPYDHSVDEREHTVEQWKELIYQEVME
YEARNNLADGEGAPR
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgagctcgcgtcacgccttctacaccgtcgaggtgggcgacaccaagtttaccattcta
aagcgataccaaaacctgaaaccgatcggttccggtgctcaaggcattgtatgtgccgca
tacgatacagtaacacagcagaacgttgccatcaaaaagctatccagacctttccaaaat
gtcactcacgccaaacgagcctacagggagtttaagcttatgaaattagtcaatcataaa
aatatcattggactgctgaacgcgttcacgccccagcgcacactagaagagttccaggat
gtgtacctggtcatggagcttatggatgcgaacctctgccaggtcatacagatggatctg
gaccacgagcggatgtcctacctgctctaccagatgctgtgcggcatcaagcatctccac
tcggcgggaattattcaccgggacttgaagccctccaacattgtggtaaagtcggactgc
acactgaaaatcctcgactttgggctggcccgtacggccggcaccaccttcatgatgacg
ccgtacgtcgtcacgcggtactaccgtgcgccggaggtcatcctcgggatgggatacaaa
gagaacgtcgacatctggtcggtcggctgcatcatgggggagatgatacgcggcggcgtc
ctgttccccggtacagatcatattgatcagtggaataaaatcattgaacaattgggtact
ccgtcccagaactttatgacgcggttgcaaccgaccgtgcggaactacgtggagaacagg
ccccgctactcggggtacgcgttcgatcggctcttcccggacgtgctgtttccgaccgac
tcgaacgagcacaaccgactgaaggctagtcaggcgcgggatctgctcagcaggatgctg
gtggtcgatccggagcatcgcatctcggtcgaccaggcgctggtgcacagctacatcaac
gtgtggttcgacgagagcgaagtgaatgcgcccgcacccggcccgtacgatcacagcgtg
gacgagcgcgagcacacggtcgagcagtggaaggagctgatctaccaggaggtgatggag
tacgaggcgcgcaataatctggcggacggggagggcgctccacggtag

DBGET integrated database retrieval system