KEGG   Anopheles gambiae (mosquito): AgaP_AGAP009537Help
Entry
AgaP_AGAP009537   CDS       T01036                                 

Definition
AGAP009537-PA
Orthology
K08738  
cytochrome c
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aga00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    AgaP_AGAP009537
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3R
AA seq 108 aa AA seqDB search
MGVPAGDVEKGKKLFVQRCAQCHTVEAGGKHKVGPNLHGLFGRKTGQAAGFSYTDANKAK
GITWNEDTLFEYLENPKKYIPGTKMVFAGLKKPQERGDLIAYLKSATK
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtcccagctggtgatgttgagaagggcaagaagctgttcgtgcagcggtgcgcc
cagtgccacaccgtcgaggccggtggcaagcacaaggtcggcccgaacctgcacggactg
ttcggccgcaagacgggccaggccgccggcttcagctacaccgacgccaacaaggccaag
ggcatcacctggaacgaggacacgctgttcgagtacctggaaaacccgaagaagtacatc
cccggcacgaagatggtgttcgccggtctgaagaagccgcaggagcgtggcgatctgatc
gcctacctgaagtcggccaccaagtaa

DBGET integrated database retrieval system