KEGG   Anopheles gambiae (mosquito): AgaP_AGAP009591Help
Entry
AgaP_AGAP009591   CDS       T01036                                 

Definition
AGAP009591-PA
Orthology
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
One carbon pool by folate
Class
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:aga00670]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3R
AA seq 923 aa AA seqDB search
TNGHYQQQQEELKIAIIGQSNFAAEVLELLLERDHLIVGVFTIADKAAREDVLATVARQH
GIPVFKFSAWRRKGVPIPEVLEQYRSVGANLNVLPFCSQFIPMEVIDGAAYGSICYHPSI
LPLHRGASAISWTLIEGDERAGFSIFWADDGLDTGPILLQKQCPVYGDDTLDTLYKRFLY
PEGVTAMAEAVDMIAAGTAPKIPQTEIGASYDPALFREENQYLNLNQPAVRIFNFIRGLD
SVPGALAVVRMEDGEEVPVRLYGASLSARRSMVNGKPIQFKGSTGSAFVTREGIFITGTD
GSLVRVRRIKRGNRVIPAGEWFEQMGTTKATPLVLTEKEQEQDTLLRSIWKSILKVEIGP
ETDFFACGAGSMDVVRLVEEVKDTLEVPIDNETLFMAPMYGEFLQEVIQRMRSGSNGDRG
TNIPLDYKHVVLKANRRQIVVPTQLFINGRFVDAEGAKTIPIVNPTNEKVICDVANASKA
DVDDAVQAADEAFRGVWTSVSARERGQLMYRLAELMEQHREELATIESIDSGAVYTLALK
THVGMSIDAWRYYAGWADKIEGSTIPVSPARPNRVLTFTKKEPIGVCALITPWNYPLMML
SWKMAACIAAGNTVVIKPAQVCPLTALKFAELTVRAGFPPGVINVVTGTGSLAGQALADH
PAVRKLGFTGSTPIGKRIMASCAESNIKKCSMELGGKSPLVIFADCDLEKAVRLGMSSVF
FNKGENCIAAGRLFVEDRIHDEFVRKVIRGIKTMKIGDPLDRATAHGPQNHRVHLEKLQE
YCAIGVKEGAKLLYGGKRVPKMEGLFFEPTVFTDVEDHMYIAREESFGPIMVISKFHASD
FDALVARANSTEYGLASGVFTQDIAKALRFAERVEAGTVFVNTYNKTDVAAPFGGFKQSG
FGKDLGKEALNEYLKTKCVTVEY
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
accaatggccattatcagcagcagcaagaggagctcaaaattgccatcatcgggcagagc
aactttgccgccgaagtgctcgaactgctgctcgagcgtgatcatctcatcgtcggtgtg
ttcacaatcgccgacaaagccgcccgcgaagatgtactggctaccgtagcccgccagcat
ggcattccagtgtttaaattctccgcctggcgtcgcaaaggtgtccccataccggaggtg
ctcgagcagtaccgatcggtcggtgcgaacctgaacgtgctcccgttctgcagccagttc
atcccgatggaggtgatcgatggggccgcttacggcagcatctgctatcatccctccata
ctgccacttcaccgaggcgccagtgccatctcctggacgctgatcgagggggacgaacgg
gccggtttctccatcttctgggcggacgatgggctggacactggaccgattctgctgcag
aaacagtgccccgtttatggggacgacacgctcgacacactgtacaagcggttcctctac
ccggagggtgtaacggctatggcggaggcggtggatatgatcgctgcgggtactgcgcca
aagatcccgcagactgagatcggtgcgagttatgatccggccctgtttcgggaggagaat
cagtacctaaacttgaaccaaccagcggtgaggattttcaacttcattcgtgggttggat
tcggttccgggagcgctggctgtagtgcggatggaagatggcgaggaagtaccggtccgg
ctgtacggtgcatcactcagtgcccggcgcagcatggtgaatgggaagccaatccagttt
aaagggtccaccgggtctgcttttgtaacgcgtgaaggcattttcatcaccggaaccgat
ggatcgttggtgcgcgtgcggcggatcaagcgtggcaatcgtgtcattcccgccggggag
tggtttgagcagatggggacgacgaaagcgaccccgctggtgctgacggagaaagagcag
gagcaggatacgctgctgcgcagcatatggaaatcgatcctgaaggtggagattgggccc
gagacggactttttcgcgtgcggtgccggctcgatggatgtggtgcggttggtggaggag
gtgaaggacacgcttgaggtaccgatcgacaacgagacgctctttatggcaccaatgtac
ggggagtttctgcaggaagttattcaacggatgcgctccggaagcaatggcgatcgtgga
acgaacattccgctggattacaaacacgtggtgttgaaggcgaatcgacgccagatagtc
gtcccaacgcagctcttcatcaatgggcggtttgtggatgcggagggtgcaaaaacgata
ccgatcgttaatccgaccaacgaaaaagtgatctgtgacgtggcgaatgcatccaaagcg
gacgttgacgatgcagttcaagccgccgatgaagcgttccgtggcgtatggacgtccgtt
tcggcacgtgagcgcggtcagctgatgtaccgattggcagagctgatggagcagcaccgg
gaggaactggcaacgattgagtcgatcgattcgggtgcagtttacacgcttgcactgaaa
actcacgtcggtatgtcgatcgatgcgtggcgctactatgctggttgggcggataagatc
gaaggtagcacgattccggtcagcccagcccgcccgaatcgtgtgctaacgttcacgaag
aaggaaccgatcggtgtgtgcgctttaattacaccctggaactacccactgatgatgctc
tcgtggaagatggccgcttgcattgccgcaggcaacacggttgtgattaaaccagcccag
gtgtgtcccttgacggcactaaagtttgccgagcttacagtaagagccggctttccaccg
ggagtgataaatgtcgtcacgggtacgggctcgttggccggccaagcccttgcagaccat
ccagcggtgcgcaaactgggcttcaccggatccactccaatcgggaaacgcatcatggct
tcgtgcgccgaatccaacatcaaaaagtgctccatggagctgggcggcaagtcgccgctc
gtcatcttcgccgactgcgatctcgagaaggcggtccggctcggcatgtcgtcggtgttt
ttcaacaagggtgaaaactgtattgccgctggccggctgtttgtggaggaccgcatccac
gatgagtttgtgcggaaagtgatccgcggcataaagacgatgaaaattggcgatccactc
gaccgggcgacggcacatggaccgcagaaccatcgggtacatctagagaagctacaggag
tactgtgctatcggcgtgaaggagggagcgaagctgctgtacggtggcaagcgggtgccc
aaaatggagggactgttcttcgagccgaccgtgtttaccgacgtggaggatcacatgtac
attgcgcgcgaagaatcgttcggtccgatcatggtgatatcgaagtttcacgcgagcgat
ttcgatgcgctggtggctagggctaacagtaccgagtacgggctggcgagtggtgttttc
acgcaggacattgccaaagcgcttcggtttgcggagcgggtcgaggcgggcacggtgttt
gtgaacacgtacaacaagacggacgtggcggctccgttcggtggcttcaagcagagcggc
ttcgggaaggatttaggcaaggaagcgttgaacgagtacctcaagactaagtgcgtgact
gtcgagtactaa

DBGET integrated database retrieval system