KEGG   Anopheles gambiae (mosquito): AgaP_AGAP009676Help
Entry
AgaP_AGAP009676   CDS       T01036                                 

Definition
AGAP009676-PA
Orthology
K11307  
histone acetyltransferase MYST2 [EC:2.3.1.48]
Organism
aga  Anopheles gambiae (mosquito)
Brite
Enzymes [BR:aga01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     AgaP_AGAP009676
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3R
AA seq 692 aa AA seqDB search
QFQSTSTESSSGSSSDSSSSGSDSGSSGGSDSGSSSSERAVKASTVVKSLHKTNNNGAGT
ATGAVKKPTPGTAQSSSAPATKGKKKSIFSPVNSSESEVETTPEKSDMQDRRTSSSSSTS
GNAASGGGTGPASSDLSDKNQPGATGSTATNTTTSTAATAALQRGRGRPRKASQVGTLNN
AVSKPIGQVKPQTSGTSSAASKVASPPLAKSMKSPIRALSSATSSSSESSSSGSSDSETE
SSDDSSPSISAAAAQSYKKSNSTMKRALERTPQKNDAKDGGAAAAAAAGSDSDRQTRKLT
RSASTRKSKHLLGKNASETDSDADSVKRSASKSPAKKAPTVPSKGKAKNNIANALASKRT
GDKPLAKELPIEEAPVERRCPLERCDSLGHMGGQFEKHFTLEACPLYHNMTVDQTKQLLV
ERKQREDERRRSIPVYENSKKIQTPEQKLYAQKIRDLRARFKPSSPTPSAERPKPLLDRD
CNEIKPEPNLEGIVPDYDLQLFREAQALASESIEKELGDMVTGKGTKYISMGRHCMQVWY
QSPYPDDATRLPKLYLCEFCLRYQKSEVGMKRHAAKCVWRHPPGDEIYRKGKLGVWQVDG
KRHKQYCQHLCLLAKFFLDHKTLYYDVEPFLFYVMTLADSDGCHTVGYFSKVVLFPFILF
QEKNSFLNYNVSCILTLPPYQRKGYGRLLIDF
NT seq 2076 nt NT seq  +upstreamnt  +downstreamnt
caatttcagtccaccagcaccgaatccagtagcggcagttcgtctgactccagctctagt
gggtccgattcgggaagctcgggcggatccgattcgggaagctcgagcagtgaaagggcg
gtgaaggctagcacggtggtaaaaagtttgcacaagaccaacaataatggggccggtacg
gcaacgggtgctgtaaagaaacccaccccaggtaccgctcagtcatcctcggcacctgct
accaagggtaaaaagaagagcatcttctcaccggtcaattcgtccgaatcggaggtggaa
acaacgccggaaaagtccgacatgcaggatagacgtacgtccagctcgagctccacgagc
gggaacgccgcgtcgggtggtgggacgggcccagcgtcgtccgatttgtctgacaaaaat
caacctggagcaacggggagtacagcaaccaacaccaccacctcaacagcagccaccgcc
gctctacaacgtggtcgaggccggccacggaaagcatcgcaggtgggaacgttgaacaac
gctgtatcgaaaccgattggacaggtgaaaccacagaccagtggcacaagcagtgccgct
agcaaagtggccagtccaccgttggccaaatcaatgaaatcccccatccgagcgctgtcg
tcggccacgtccagctcgagcgaatcgtcctccagcggatcgtccgactcggaaacggaa
tcatcggacgattcctcaccatcgatcagtgcggcggccgcacaaagctacaaaaagtcc
aacagcaccatgaagcgtgcgctcgaacgaacgccccaaaagaacgatgcgaaggatggc
ggtgcggcggcggcggcggcggccggttcggactcggaccggcagacgcgaaagctgacc
cgttccgcaagcacgcgcaaatccaaacacctgctcggcaagaacgcctccgagacggac
tccgacgcggacagtgtgaagcggtccgcgtcgaaaagtccggcgaagaaagcgcccacc
gtaccgtcgaagggtaaggcgaaaaacaacattgccaacgcgctggccagcaaacgcacc
ggcgacaaaccgctcgcgaaggagctgcccatcgaggaggcgccggtcgagcggcgctgt
ccgctggaaaggtgtgactcgctcggccacatgggcggacagtttgagaagcactttacg
ctggaggcttgcccgctctaccacaacatgacggtcgatcaaacgaagcagctgctggtg
gagcgcaagcagcgcgaagacgaacggcgccggtcgattccggtgtacgaaaattcgaaa
aagatccaaacgcccgaacagaagctgtacgcgcagaagatacgcgatctgcgggcgcgc
tttaaaccctcctcgccgacgccgagtgccgagcggccgaaaccgttgctcgatcgggac
tgtaacgaaattaagcccgaacctaacctcgagggcatcgtgccggactacgatctgcag
ctgttccgcgaagcgcaggcactggcgagcgaaagtatcgagaaggagctgggtgatatg
gttaccgggaagggcacgaagtacatttcgatgggccggcactgtatgcaggtgtggtac
cagtcgccctatccggacgatgcgacccggctgccgaagctgtatctgtgcgagttctgt
ctgcggtatcaaaagtccgaggtgggaatgaagcgccatgcggccaaatgtgtctggcgg
catccgccgggcgatgagatctatcgcaagggaaagcttggtgtgtggcaagtggatggc
aagcgacacaaacagtactgtcagcatctgtgcttgctggccaaattcttcctcgaccat
aaaacattgtactacgacgtggaaccgttcctgttttatgtgatgacgctggcggatagt
gacggctgccatacggtggggtatttcagtaaggtagttttgttcccatttattttgttc
caggagaaaaactcgttcctcaactacaacgtgtcgtgtatccttacgctaccgccgtac
cagcgtaagggctatggacggttgctgatcgacttc

DBGET integrated database retrieval system