KEGG   Anopheles gambiae (mosquito): AgaP_AGAP009695Help
Entry
AgaP_AGAP009695   CDS       T01036                                 

Definition
AGAP009695-PA
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Class
Metabolism; Overview; Fatty acid metabolism [PATH:aga01212]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:aga00062]
Cellular Processes; Transport and catabolism; Lysosome [PATH:aga04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3R
AA seq 291 aa AA seqDB search
LTEMFRTLGATVLLLKISLTIAYRPVFIYHGILTGADSMGHLVNRIQEACVHPGTVVYNF
GRFGGWASLINAWHQVQAAHDNLKLVCDLHPDEGINMIGYSQGGLLGRAVLQIYPDHCVK
TFISLSSPQAGQFGDDFLHLIFPSLVARTAYELFYSRVGQDTSVGNYWNDPHHPDLYEQY
SIFLPYVNNQLPSVNSTQYREALLRLNRMVLIGGPDDGVITPWQSSHFSFFDQKYNVLPL
EESVIYTEDWIGLKTLQESGRLHIIERQHVRHYQWHRTNDVIDDVIMPYLD
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
cttaccgaaatgttccgaacgctaggcgccaccgttttgctgctgaaaataagcctcacg
attgcgtatcggcctgtgttcatctaccatggcattcttactggtgcggatagtatgggg
catttggtcaatagaatccaggaggcatgtgttcaccctggcacggtggtgtacaatttt
ggtcgattcggtggatgggccagtctgataaatgcctggcatcaggtgcaagcggcacac
gacaacctgaaattagtctgcgatttgcatcccgacgagggcatcaacatgatcggctat
tcgcagggtggtctgctgggtcgggcagtgctgcagatctatccggaccactgtgtgaag
acattcatctcactaagctccccgcaagcgggtcaattcggagatgactttttgcattta
atcttcccctcgctcgtagcacgaacggcgtacgagcttttctactcgcgcgtcggccag
gacacgtccgtgggcaactactggaacgatccgcaccatccggatctgtacgagcagtat
agcattttcctgccatacgtcaataatcagcttccctccgtcaactctacccagtaccgg
gaggcgctactgcggctcaaccggatggtgctgattggtgggcccgatgatggggtgatt
acaccctggcagtctagtcattttagcttcttcgaccagaagtacaacgtgctgccgctg
gaggagagtgtgatttacaccgaagattggatcggactgaaaacgctacaggaaagtggc
cgattgcacataatcgaacgccaacatgtgcgtcactatcagtggcatcggacgaacgat
gtgatcgacgatgtgattatgccatatttggactag

DBGET integrated database retrieval system