KEGG   Anopheles gambiae (mosquito): AgaP_AGAP009777Help
Entry
AgaP_AGAP009777   CDS       T01036                                 

Definition
AGAP009777-PA
Orthology
K04500  
mothers against decapentaplegic homolog 2/3
Organism
aga  Anopheles gambiae (mosquito)
Pathway
FoxO signaling pathway
Endocytosis
TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:aga00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    AgaP_AGAP009777
   04068 FoxO signaling pathway
    AgaP_AGAP009777
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    AgaP_AGAP009777
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3R
AA seq 506 aa AA seqDB search
MLPFTPPIVKRLLGWRKVSPDDSAEGKWGEKVIKSLAKKMKKSSALEELERALTAQSSHT
KCIPISRNASAIGENGVALKKGLPHVICCRLWRWPDLNSHTELKPLDVCEYAYHLKKDEV
CINPYHYARNESHSQHSQQQQSPQQQQSSQQLQQPLTILVPKNLSNSQGENSVTYTLDDL
SNTVPVNTQYNALNDNYVTSPQPSQVTSRQLQQQQLQPNQLHQQLQQQQQQQQLSSPCYM
EATLGQQIPTNTTIMDSVSVGVPNIPNTETPPPGYMSEDGDPLDQNDNMTDLSRMSPSEM
DTQPVMYHEPTFWCSISYYELNLRVGETFHASQPSITVDGFTDPSNSERFCLGLLSNVNR
NEVVEQTRRHIGKGVRLYYIGGEVFAECLSDSSIFVQSPNCNQRYGWHPATVCKIPPGCN
LKIFNNQEFATLLSQSVSMGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELH
LNGPLQWLDRVLTQMGSPRLPCSSMS
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgttgcccttcacaccgccgattgtgaagcggttgctcggctggcggaaggtttcgccg
gatgattccgccgaaggaaaatggggcgaaaaggtgatcaaaagtttggccaaaaagatg
aaaaagtccagcgccctggaagagctagagcgggcccttacagcacagagcagccacacg
aaatgcataccgatatcaagaaatgcttcggcgatcggagaaaatggagttgcgctaaag
aaaggtcttccacacgtcatatgctgtcgattgtggcgctggcctgatttgaatagccat
accgaattgaaaccgctcgacgtatgcgaatacgcatatcatcttaaaaaggacgaggtg
tgcattaatccatatcactacgcacgcaacgaaagccattcacagcactcgcagcaacaa
cagtcaccgcagcagcaacagtcatcacagcagctgcagcaaccgctgaccatcttggtt
ccgaagaacctatcaaactctcagggagaaaactccgttacctacaccttggacgatctt
agtaataccgtaccagtcaacacacagtacaatgcattaaatgataactatgtaaccagc
cctcaaccatcgcaagtaacgtcacgccagctacaacagcagcaactacagcccaatcaa
ttgcatcagcaacttcaacagcagcagcagcagcagcaactttcttccccgtgctacatg
gaggcaacactgggccaacagataccgaccaacacgacgattatggactcggtcagcgtc
ggtgtgccgaacataccgaataccgagacgccaccacccggctacatgtcagaggatggt
gatccactcgaccagaatgacaatatgaccgatttgtcgcgcatgtcgccatcggagatg
gatacacagccggtgatgtaccatgagccgacattctggtgctcgatcagctattacgaa
ctgaacctgcgcgtcggtgaaacgtttcatgcctcccaaccttcgatcacagtcgacggc
tttacggatccttccaattcggaaagattctgtcttggcctgctgtcgaatgtgaaccgg
aatgaggtggtggaacagactcgacgtcacatcggcaagggtgtccggctgtactacatt
ggcggtgaggtatttgccgaatgtttgagcgactcgagcatcttcgtgcagagcccgaac
tgtaatcagcggtacgggtggcatcctgcaacggtgtgtaaaataccaccgggatgcaat
ttaaaaatctttaacaatcaggaatttgctaccctactgtcccagtccgtatcgatgggc
tttgaagccgtttatcagctgacccggatgtgcacaatccggatgtccttcgtgaagggt
tggggagcagaatatcgccgacaaaccgttacctctacgccctgctggatagagctgcat
ttaaacggtcccctgcagtggctggaccgagtactcacccagatgggctcaccacgtttg
ccatgtagttctatgtcctaa

DBGET integrated database retrieval system