KEGG   Anopheles gambiae (mosquito): AgaP_AGAP009777Help
Entry
AgaP_AGAP009777   CDS       T01036                                 

Definition
AGAP009777-PA
Orthology
K04500  
mothers against decapentaplegic homolog 2/3
Organism
aga  Anopheles gambiae (mosquito)
Pathway
FoxO signaling pathway
Endocytosis
TGF-beta signaling pathway
Class
Environmental Information Processing; Signal transduction; TGF-beta signaling pathway [PATH:aga04350]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:aga04068]
Cellular Processes; Transport and catabolism; Endocytosis [PATH:aga04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3R
AA seq 506 aa AA seqDB search
MLPFTPPIVKRLLGWRKVSPDDSAEGKWGEKVIKSLAKKMKKSSALEELERALTAQSSHT
KCIPISRNASAIGENGVALKKGLPHVICCRLWRWPDLNSHTELKPLDVCEYAYHLKKDEV
CINPYHYARNESHSQHSQQQQSPQQQQSSQQLQQPLTILVPKNLSNSQGENSVTYTLDDL
SNTVPVNTQYNALNDNYVTSPQPSQVTSRQLQQQQLQPNQLHQQLQQQQQQQQLSSPCYM
EATLGQQIPTNTTIMDSVSVGVPNIPNTETPPPGYMSEDGDPLDQNDNMTDLSRMSPSEM
DTQPVMYHEPTFWCSISYYELNLRVGETFHASQPSITVDGFTDPSNSERFCLGLLSNVNR
NEVVEQTRRHIGKGVRLYYIGGEVFAECLSDSSIFVQSPNCNQRYGWHPATVCKIPPGCN
LKIFNNQEFATLLSQSVSMGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELH
LNGPLQWLDRVLTQMGSPRLPCSSMS
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgttgcccttcacaccgccgattgtgaagcggttgctcggctggcggaaggtttcgccg
gatgattccgccgaaggaaaatggggcgaaaaggtgatcaaaagtttggccaaaaagatg
aaaaagtccagcgccctggaagagctagagcgggcccttacagcacagagcagccacacg
aaatgcataccgatatcaagaaatgcttcggcgatcggagaaaatggagttgcgctaaag
aaaggtcttccacacgtcatatgctgtcgattgtggcgctggcctgatttgaatagccat
accgaattgaaaccgctcgacgtatgcgaatacgcatatcatcttaaaaaggacgaggtg
tgcattaatccatatcactacgcacgcaacgaaagccattcacagcactcgcagcaacaa
cagtcaccgcagcagcaacagtcatcacagcagctgcagcaaccgctgaccatcttggtt
ccgaagaacctatcaaactctcagggagaaaactccgttacctacaccttggacgatctt
agtaataccgtaccagtcaacacacagtacaatgcattaaatgataactatgtaaccagc
cctcaaccatcgcaagtaacgtcacgccagctacaacagcagcaactacagcccaatcaa
ttgcatcagcaacttcaacagcagcagcagcagcagcaactttcttccccgtgctacatg
gaggcaacactgggccaacagataccgaccaacacgacgattatggactcggtcagcgtc
ggtgtgccgaacataccgaataccgagacgccaccacccggctacatgtcagaggatggt
gatccactcgaccagaatgacaatatgaccgatttgtcgcgcatgtcgccatcggagatg
gatacacagccggtgatgtaccatgagccgacattctggtgctcgatcagctattacgaa
ctgaacctgcgcgtcggtgaaacgtttcatgcctcccaaccttcgatcacagtcgacggc
tttacggatccttccaattcggaaagattctgtcttggcctgctgtcgaatgtgaaccgg
aatgaggtggtggaacagactcgacgtcacatcggcaagggtgtccggctgtactacatt
ggcggtgaggtatttgccgaatgtttgagcgactcgagcatcttcgtgcagagcccgaac
tgtaatcagcggtacgggtggcatcctgcaacggtgtgtaaaataccaccgggatgcaat
ttaaaaatctttaacaatcaggaatttgctaccctactgtcccagtccgtatcgatgggc
tttgaagccgtttatcagctgacccggatgtgcacaatccggatgtccttcgtgaagggt
tggggagcagaatatcgccgacaaaccgttacctctacgccctgctggatagagctgcat
ttaaacggtcccctgcagtggctggaccgagtactcacccagatgggctcaccacgtttg
ccatgtagttctatgtcctaa

DBGET integrated database retrieval system