KEGG   Anopheles gambiae (mosquito): AgaP_AGAP009798Help
Entry
AgaP_AGAP009798   CDS       T01036                                 

Definition
(RefSeq) AGAP009798-PA
  KO
K07376  cGMP-dependent protein kinase 1 [EC:2.7.11.12]
Organism
aga  Anopheles gambiae (mosquito)
Module
aga_M00694  cGMP signaling
Brite
Enzymes [BR:aga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     AgaP_AGAP009798
Protein kinases [BR:aga01001]
 Serine/threonine kinases: AGC group
  PKG family
   AgaP_AGAP009798
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase cNMP_binding Pkinase_Tyr Kinase-like Seadorna_VP7 APH
Motif
Other DBs
NCBI-GeneID: 1279209
NCBI-ProteinID: XP_318891
VectorBase: AGAP009798
UniProt: Q7Q1G7
Position
3R
AA seq 959 aa AA seqDB search
PSSPPQSTTVVSTVVKSNERESGLGSLDERLNITGNATANDTNRELPDPIASRPRDSEKA
KISCSSRETSTIEPPTKQGQEQLLKDLLQNKILHMLAIQSKGYSQLSKSERATLVRLEEE
IQELQKKSKAPEKPQQLPQPTNEPKKTEQDRRNSANSYETNLPPLTMPSVIEQSVTKSDN
RTEEPLQDGEMSDYDVIPGQKPNDEVVPEAPSSEDDRSTVLPPDLPPRLSRVNNVEEADD
TSQDEEPTPPKLPPPRSQLEQNLAVDEMLSRSLQETIIRQSAREDEKEIPLPTAPPPSRE
PPPIPSSDQQTIDNDPQATTPPRKEMLRKVSSQRSLIEELDSKIGTLKKTRKQGVVSDKT
DLKESKDIVIPTHPKSPDTELLIKTAIVANDFLNNMMDEERLQAVTAAMSSMTFPPNSYI
IKEGDIGAHFFVSEEGTYEVVVDNKVIKSFGRGVVFGELAILYKAKRFASIRVTTGARVW
LLERKVFQKIMMKSGRKEREENVRFLSTVSVLKDLEIEKLHKISDLLKREFYATGSTIIQ
QGDPGDKFYIIRGGSVNVIKTDKKGNDRLVGTLQRGAYFGEQALLHEDRRLASIIANPPG
TECLTLNRIAFNEFLGGLEKLREVKLSDTIPRSSTMTNIVSEYDHIQLHDLTYIGTLGIG
GFGRVELVQYKNHQTFALKYLKKIEMVRQQQQEHAYSEKDIMLSCNSPFIVRLYKTYRDK
KYLYFLMEACLGGDVWTVLQKSKFFDERTARFITGCVVEAFEYLHSRNMIYRDLKPENLM
LDEKGYIKLVDFGFAKRIGPNQKTWTFAGTPEYVSPEIILNKGHDRAVDYWALGVLIHEL
LVGKPPFRGKNHMKTYNAILRGIDIIELPSRVPKKAQVLIKRLCRQTAAERLGYGKNGIA
DIKNHPWFGSFEWQKLKERTMPAPLIRPIVSDIDLSNFDEYPKDQDEPPDETSGWDINF
NT seq 2880 nt NT seq  +upstreamnt  +downstreamnt
ccatcatcaccgccacagtcgaccaccgtggtctcaacggtggtgaaatcaaatgaacgt
gagtcggggctgggatctttggacgaacgattaaacattacaggcaacgctacggcaaac
gacactaatcgcgagctccccgatcctatcgcatcgaggccacgcgactcggaaaaggcc
aaaataagttgcagttctcgggaaacatcaaccatcgaaccaccaaccaagcagggccag
gagcagctgctaaaggatctgctacagaacaagatcctacacatgttggccatccaatct
aaaggatacagtcagctatcgaaaagcgaacgggcaacgctggttcggctggaagaagaa
atacaagagctgcaaaagaagagcaaagctccggagaagccgcaacaactaccgcagccc
accaatgagccaaagaagacagagcaagatcgtcgcaatagtgccaactcgtacgaaacg
aatctcccaccactgacaatgccatcggtaatcgagcagtctgttacaaaatctgacaac
cgtactgaagagcccctgcaggatggcgaaatgtccgactacgatgtgatcccgggacag
aaaccaaacgatgaagtcgtcccggaagcacccagttcggaggatgacagatcgacggta
ttgccaccagatttaccgcctcgattgagcagggttaacaatgtggaagaagcggacgat
acctcgcaggatgaggaaccgacaccgccgaagttgccaccaccaagaagtcagctggaa
cagaaccttgccgtagatgagatgttgagtagatcgctgcaggaaacgatcattcgacag
agtgctcgggaagacgaaaaggaaatacctttaccaacggccccaccaccatcacgagag
cctccgccaattccttcatccgatcaacaaacgatagacaatgatccacaagcaacaacc
ccaccacgtaaggaaatgctgcgcaaggtgtcttcccaacggtcgctcattgaggagctg
gacagtaaaatcggcacgctgaagaagacccgcaaacagggcgtagtgtcggacaagacc
gatctgaaggaatcgaaggacattgtcatcccaacgcacccgaagagcccggacacggag
ctcctaatcaagaccgccatcgtagcgaacgacttcctcaacaacatgatggacgaggaa
cggttacaggccgtaacggcggccatgagttcgatgacgttcccaccaaacagctacatc
atcaaggagggtgacattggggcgcacttcttcgtctcggaagaaggcacatacgaggtc
gtggtggacaataaggttattaaatcgtttggccgtggcgttgtgtttggtgagctggcg
atcctctacaaagcgaaacgatttgcctcgatccgcgtgacgacgggagcgcgcgtttgg
ttgctggagcgcaaggtcttccagaagatcatgatgaagagcggtcggaaggagcgggaa
gaaaacgtacgcttcctaagcacggtatcggtattgaaggatttggagattgagaagctg
cacaaaatatcggacctcttgaagcgggagttctatgccaccggttcgaccatcatccag
cagggagatccgggagacaaattctacatcatacgcggcggcagcgtaaacgtcatcaaa
actgacaaaaagggcaacgaccgtctggtcggaacgctgcagcgtggtgcatacttcggt
gagcaggccctcctccacgaggaccgtcgtctggccagcattattgcaaacccaccggga
accgagtgtctgacgctgaaccgcattgcattcaacgagttcctgggcggattggagaag
ctgcgtgaggtgaaactctccgacacgataccacgcagctcgacgatgacaaatattgtc
tcagagtacgaccatatccagttgcacgatctgacctacatcggaacgcttggcatcggt
ggtttcgggcgggtggagctggtccagtacaaaaaccaccaaacctttgccctcaaatac
ctgaaaaagatcgaaatggtacggcagcagcagcaggagcacgcctacagcgaaaaggac
atcatgctaagctgcaacagtccgttcatcgtacgcctgtataaaacctaccgtgacaag
aagtatctctacttcctgatggaggcctgtctcggcggtgacgtctggaccgtgctgcag
aagagtaagttcttcgacgagcgcaccgctcgcttcataacgggctgtgtcgtcgaagcg
ttcgagtatctgcacagccggaacatgatctaccgtgacttgaagccggaaaatctaatg
ctggacgagaagggctacatcaagctggttgactttgggtttgccaagcgcatcggaccg
aaccagaagacgtggacgttcgccggtacgccagagtacgtgtcgccggaaatcatcctc
aacaagggtcacgaccgggccgtcgactactgggcgctgggtgtgctgattcacgagctg
ctggtcgggaagccaccgttccggggcaagaatcacatgaagacgtacaatgccatcctg
cgcggtattgacatcattgagctaccgtcccgcgtacccaagaaggcacaggtgctgatt
aagcgcctctgccgacagacggcggccgaacggctggggtacggcaagaacggtatagcc
gacattaagaaccatccctggttcgggagcttcgagtggcaaaagttgaaggaacgaacg
atgccagcgcctctcatacgtcccatcgtgtccgatattgatttgtcgaactttgacgag
tacccgaaggatcaggacgaaccgccagacgaaacgtcgggatgggatattaatttttaa

DBGET integrated database retrieval system