KEGG   Anopheles gambiae (mosquito): AgaP_AGAP009861Help
Entry
AgaP_AGAP009861   CDS       T01036                                 

Definition
(RefSeq) AGAP009861-PA
  KO
K05759  
profilin
Organism
aga  Anopheles gambiae (mosquito)
Pathway
MAPK signaling pathway - fly
Brite
KEGG Orthology (KO) [BR:aga00001]
 Environmental Information Processing
  Signal transduction
   04013 MAPK signaling pathway - fly
    AgaP_AGAP009861
Membrane trafficking [BR:aga04131]
 Others
  Actin-binding proteins
   Others
    AgaP_AGAP009861
Cytoskeleton proteins [BR:aga04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     AgaP_AGAP009861
Exosome [BR:aga04147]
 Exosomal proteins
  Proteins found in most exosomes
   AgaP_AGAP009861
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3R
AA seq 126 aa AA seqDB search
MSWQDYVDNQLLASQCVSKAAIAGHDGGVWAKSEGFEVSKEEVAKIVQGFDKTELLTSGG
VTLAGQRYIYLSGTDRVIRAKLGKTGVHCMKTQQAVIVSIYEEPVQPQQAASIVEKLGDY
LITCGY
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgagctggcaggattacgtcgacaatcagcttctcgcctcgcagtgcgtgtcgaaggca
gccatcgccggtcacgatggtggcgtttgggccaaatcggagggctttgaggtgtcgaag
gaggaggtggccaaaattgtacagggatttgacaaaaccgaactgctcacatccggcggt
gtgacactagcgggccaacgttatatctatctgtccggtactgaccgagtgatccgtgcc
aagctcggcaaaaccggtgtgcactgtatgaagacgcaacaggctgttatagtatctatc
tatgaggaacccgtgcagccccagcaggcggcatccatagtagaaaagctgggcgattat
ctaattacctgtggttattag

DBGET integrated database retrieval system