KEGG   Anopheles gambiae (mosquito): AgaP_AGAP009861Help
Entry
AgaP_AGAP009861   CDS       T01036                                 

Definition
AGAP009861-PA
Orthology
K05759  
profilin
Organism
aga  Anopheles gambiae (mosquito)
Brite
Exosome [BR:aga04147]
 Exosomal proteins
  Proteins found in most exosomes
   AgaP_AGAP009861
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3R
AA seq 126 aa AA seqDB search
MSWQDYVDNQLLASQCVSKAAIAGHDGGVWAKSEGFEVSKEEVAKIVQGFDKTELLTSGG
VTLAGQRYIYLSGTDRVIRAKLGKTGVHCMKTQQAVIVSIYEEPVQPQQAASIVEKLGDY
LITCGY
NT seq 381 nt NT seq  +upstreamnt  +downstreamnt
atgagctggcaggattacgtcgacaatcagcttctcgcctcgcagtgcgtgtcgaaggca
gccatcgccggtcacgatggtggcgtttgggccaaatcggagggctttgaggtgtcgaag
gaggaggtggccaaaattgtacagggatttgacaaaaccgaactgctcacatccggcggt
gtgacactagcgggccaacgttatatctatctgtccggtactgaccgagtgatccgtgcc
aagctcggcaaaaccggtgtgcactgtatgaagacgcaacaggctgttatagtatctatc
tatgaggaacccgtgcagccccagcaggcggcatccatagtagaaaagctgggcgattat
ctaattacctgtggttattag

DBGET integrated database retrieval system