KEGG   Anopheles gambiae (mosquito): AgaP_AGAP009979Help
Entry
AgaP_AGAP009979   CDS       T01036                                 

Definition
AGAP009979-PA
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
aga  Anopheles gambiae (mosquito)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aga00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    AgaP_AGAP009979
Enzymes [BR:aga01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase
     AgaP_AGAP009979
Glycosyltransferases [BR:aga01003]
 Glycan extension
  Type 3 chain
   AgaP_AGAP009979
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3R
AA seq 417 aa AA seqDB search
ICNIQLCCISGPRNGSHPRTFITLLFGTVLGFMFATFISSTTLRQPWMPESYRQREPPSI
VSDPHTGNELRGASGPEQDVGQHAAHEEAHAHENASIAQQLHREVRVLCWVMTNPSNHKS
KALHVKRTWAGRCNKVLFMSSVEDPLIDSVALPVSEGRNNLWAKTKEAFKYIYQNHLDDA
DWFMKADDDTYVVVENLRYMLYSYSPSHPIYFGCRFKPFVKQGYMSGGAGYVLSKEAVKR
FVEDAIPSPLCRQDSDGAEDVELGKCMEAVKVLAGDSRDTVGRGRFFPFVPEHHLIPNHV
DKDFWYLKYTYYKPDEGLECCSDNAISFHYVSPNQMYVLDYLIYHLRPYGIVAHSQPLPK
KLSLGDIVRVDDLGKTTPKPSAQQHRRYKVSSNRGKAGNEMQEEVTFSDMKAKEPNT
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atatgtaacattcaactctgttgtatttcaggtccacgaaatggcagtcatcctcgaaca
ttcattacgttactgtttggcactgtactgggctttatgtttgccacctttatctcatct
acaactttacgccaaccatggatgcccgagagttatcgtcagcgcgagccaccgtcgatc
gtaagtgacccgcacaccgggaacgaattgcgtggagcctccggccctgagcaggatgtt
ggacagcatgcagcccacgaagaagcgcacgcgcacgaaaatgcatccattgcgcaacag
ttgcatcgggaagtgcgcgtcctgtgttgggtgatgaccaatccgagcaatcacaaatcg
aaagcgttacacgtgaagcgcacgtgggctggtcggtgtaacaaagtacttttcatgagt
tccgtagaagatcccctcatagactccgtcgcgttgcctgtgagcgaaggtcgaaataat
ctgtgggcgaaaacgaaagaagctttcaagtatatttatcagaaccatctggacgacgct
gattggttcatgaaggcagacgatgacacgtacgtggtcgtggaaaatttgcgttacatg
ctttactcgtactcgccgtctcacccgatctattttgggtgccgctttaagccgttcgta
aagcaaggttacatgtccggtggagcgggatatgtgctaagcaaggaggcggtgaaacgc
tttgtcgaagatgccattcccagccccttgtgtcggcaagatagtgacggtgcggaggac
gtggagttgggaaaatgcatggaagcagtgaaagtgttggccggtgattcaagggatacg
gtcgggcggggaagatttttcccatttgtacctgagcaccatcttatcccaaatcacgtg
gacaaagacttttggtatttaaaatacacatactacaagccggatgagggtctcgaatgc
tgttcggataatgccatctctttccactacgtgtcaccgaatcaaatgtacgtgctagac
tatttgatctatcatctgcgaccgtacggcatcgttgcacactcgcagcctttaccaaag
aagctcagtttaggtgatattgtaagagtggacgatctgggaaaaaccacccccaaaccg
tcagcccagcaacatcgacggtacaaagtcagcagtaaccgtggcaaagccggaaatgaa
atgcaggaggaagttacatttagtgatatgaaagctaaagaaccaaatacctag

DBGET integrated database retrieval system