KEGG   Anopheles gambiae (mosquito): AgaP_AGAP010035Help
Entry
AgaP_AGAP010035   CDS       T01036                                 

Definition
AGAP010035-PA
Orthology
K07204  
regulatory associated protein of mTOR
Organism
aga  Anopheles gambiae (mosquito)
Pathway
mTOR signaling pathway
Brite
KEGG Orthology (KO) [BR:aga00001]
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    AgaP_AGAP010035
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3R
AA seq 1295 aa AA seqDB search
DALLPVCFNCERHRGKILGINCTTQCWRVRDRMKTVSVALVLCLNIGVDPPDVVKIDKCA
RVECWINPASYSPGKALEMISYQLQKQYERWQPRARYRHSLDPTMEDVKKLCTSLRRNAK
EERVLFHYNGHGVPRPTANGEIWVFNRNFTQYIPLSIYDLQTWMGAPSIYVYDCSNAGII
VNSFHTFADQHELEVEHIRNRSGSTVGHTGGDLQAEDSRSSPSPSTGGAGTTTYRNCIQL
AACAADQLLPMNPNLPADLFTSCLTTPVKMALRWFTLQSTSKLVPEVTEELIEKIPGQLN
DRRTMMGELNWIFTAITDTIAWNTLRPELFQKLFRQDLLVASLFRNFLLAERILRAYDCT
PISSPALPPSYRHPMWSAWDLALDQALAQLPDVLEKGKPFQHSPFFEEQLTAFQVWLEGS
TEQRSPPEQLPIVLQVLLSQVHRLRALELLGHFVDLGPWAVNLALSVGIFPYVLKLLQSS
AKELRPCLVFIWAKIVAVDGTCQIDLIREQGHKYFLIALQDTNPGGQPFKGNHRTYAAFV
LASIVHNFPNGQSSALQGQLVSICLDQLNDDSNPLLRQWLAICLGHLWQNYEQARWSGVR
DNANEKLYPLLSDPYPEVRAAAVYALGTFISSVKQRSDHANNIDRSTAMHLFSTVSNDMS
PLVRMELIAALQWMVLFFESQFAGTFLQLDSPERTTNPMKRVLSTSNIIGVGKASVMVGF
YQKLWNGFIALSKDPFPEVASMAQKVVDYVRADSAKEVTVCDKSSHHYGSAASVSLPPSP
NTRVGYLAGESPPTHGGIHGPSDNGGSHHRLANQQTPLAMKKRIHAVNDSPAAGPDYTDS
PDKLAYSQSSSHSLSSSTAPLKPIVGTQYIEWSVSFFAQPSKRMNEAKAAGTDHNSYEFL
IRKSRWLRNKEVRAEGRTQRMKAIFKRLDVQSWSCRTQHAPTFIKLNPYDEQVAFAYNNL
SSSSTSSGYHSLQHHGSHRLINQSFLEQHHPTPSQSQQPSLSSFPHQLKPSNEPLPAHGF
GNHALAVTSLEFLNAHDVGVIMAGYSDSTIRLWRPKETSDENQLLSAWHGLLDFNTSSAA
KVSCSEAAPAAHGGLVLAWHQRTQTIMAAGEAKYIRLWDAEREMRICDIPSGSDTAVLKL
SCAPNGIFAAGFYDGSVRIFDRRCPPAETRCATIREHINPVLAICLRDDCESLVTADVSA
SVRLYDIRKAYSSVQNWSAGTDVSAMAIHTSADILACATSQIVIYGLDGVVLSSGRSNEG
FMAPRKGVASCLSFHKYKLNLAAGYNDNTAAVLVP
NT seq 3888 nt NT seq  +upstreamnt  +downstreamnt
gatgctttgttgccggtctgtttcaactgtgagcgacatcggggcaagatccttggcatc
aactgcacgacccaatgttggcgtgtacgagaccgcatgaaaacggtgagcgtggcgctg
gtgctgtgcctcaacatcggtgtcgacccgccggatgtggtcaaaatcgacaagtgtgcg
cgggtagagtgctggatcaatccggcatcctactcgcccgggaaagcgctagagatgatc
agttaccagctacagaagcagtacgaacggtggcagcctcgcgcccgctatcggcactca
ctcgacccaacgatggaggacgtgaagaagctgtgcacctcgctgcgtcggaatgcgaaa
gaggagcgtgtgctgttccactataacggccacggtgtgccgcgtccgacggccaatggc
gaaatttgggtgttcaatcggaatttcacgcagtacatcccgctgtccatctatgacctg
cagacgtggatgggcgctccatcgatttacgtgtacgattgctcaaacgccggcattatc
gtgaacagttttcacacgttcgccgatcagcacgagcttgaggtggagcatataaggaat
cgaagcggcagcacggtgggacacacgggcggcgacctacaggcggaggatagtcgcagc
tcaccctccccttcgaccgggggcgctggaacgacgacgtaccggaactgtattcagctg
gcggcctgcgctgccgatcagttgctgccgatgaatcccaacctgccggcggatctgttc
acctcatgccttaccacgccggtcaagatggcgctacggtggtttacgcttcaatccact
tccaagctggtgccggaggtgacggaggagctgattgagaaaattcccggccagctcaac
gataggaggacgatgatgggtgagctgaactggatttttaccgccattacggacacgatt
gcgtggaacacgctgcggcccgaactgttccagaagctgttccgccaggacctgctggtt
gcgagcctgtttcgcaactttctgctggccgagcgtatcttgcgggcgtacgactgcacg
cccatctctagtccggcgttgccccccagctatcggcatccgatgtggtcggcgtgggat
ttggccctagaccaggcgctggcccagctgccggacgtgctcgagaagggaaaaccattc
cagcattcgcccttcttcgaggagcagctgacggcatttcaggtgtggctagagggaagc
accgagcagcgcagcccgcccgagcagttgccgatcgtgctgcaggtgctgctgtcgcag
gttcaccgattgcgtgccttggagttgttgggacactttgttgatctcggtccgtgggcg
gttaatctggcgctgagcgtgggcatctttccgtacgtgctgaagctcctgcaaagctcg
gccaaggagctgcgcccgtgtctggtgttcatctgggcgaaaatagttgcagtggatggg
acgtgccagatcgatcttatccgtgagcagggtcataagtatttcctgatcgccctgcag
gacaccaatcccggcgggcaaccgttcaagggcaatcatcgaacgtacgctgcgttcgtg
ctcgctagcatcgtgcacaacttcccgaacggacagtcgagtgcactgcaggggcagctc
gtgtccatctgcctcgatcagctgaacgacgacagcaatccactgctgcggcagtggttg
gccatctgcttggggcatctgtggcagaactacgaacaagcacggtggtccggcgtgcgg
gacaatgcgaacgaaaaactgtaccccctgctcagcgatccctatccggaggtgcgagct
gctgccgtctatgcgctgggcacgtttataagctcggtaaagcaacggtcggaccatgcg
aacaacatcgatcggtcgactgcgatgcaccttttctccacggtaagcaacgatatgagc
ccgctggtacgcatggagctgattgccgcgcttcagtggatggtgctgttcttcgagtca
cagtttgccggcacgtttttgcagctggacagccccgaacggaccaccaatccgatgaag
cgcgtcctaagcacgagcaatattattggcgttggcaaagcgtccgtcatggttgggttc
tatcagaagctgtggaacggattcattgccctgtcgaaagatcccttcccggaagttgcc
tcgatggcgcagaaagtcgttgactatgtgcgcgccgacagcgccaaggaggtgacggtg
tgcgacaaaagctcgcaccactacggtagcgcggccagcgtcagtttacctccgtcgccg
aacacccgtgtcggttatctagcgggcgagtcgcccccaacgcacgggggaatacacggc
cccagtgacaacgggggcagtcaccatcgtctggcgaatcagcagacgccactagcaatg
aagaagcgtatccacgcggtaaacgacagtccagcggccggaccggattatacggacagt
ccggataaattagcgtattcgcaatcgtcctcacactctctgtcgtcatcgacggctccg
ttgaagccgatcgtggggactcagtatatcgaatggtcggtcagcttctttgcccaaccg
tcgaagcgtatgaacgaagcgaaagcggccggtacggatcacaattcgtacgaatttctc
atccgcaaatcgcgctggttgcgcaacaaagaggtacgagcggaggggcgtacgcagcgc
atgaaggcgatctttaagcggctagatgtgcaaagttggtcctgccgtacgcagcatgca
ccgacgttcatcaagctaaatccttacgacgaacaagtggctttcgcatacaacaaccta
tccagcagcagcaccagctccggttaccacagtctgcagcaccatggttcgcatcgtcta
attaatcaatccttcctggagcagcaccacccgacgccctcacagtcgcaacagccatcg
ttatcatcgttcccgcaccaactgaagccatcgaacgagccgctgcccgcgcacgggttt
ggtaaccacgcactggcagtcacgtcgctggagttcctcaacgcgcacgacgtcggtgtg
ataatggccgggtacagcgacagcacgatacgattgtggcgcccgaaggagacgagcgac
gaaaaccagctgctttcggcgtggcacggtttgctagatttcaatacatcaagcgcagcc
aaggtaagctgtagcgaggcggcaccggccgcccacggcggtctggtgctcgcatggcac
cagcgcacgcaaacgataatggcggcgggtgaagcgaaatacatacgcctgtgggatgct
gagcgggagatgcgtatctgtgatattccgagcggctccgacacggccgtactgaagctg
tcctgcgcgccgaacggtatatttgcggccgggttttacgatggcagtgtgcgcatattc
gatcgccgctgtccgccagccgagacgcgctgcgcaaccatacgggagcacattaacccg
gtgctggcgatctgcctgcgcgacgattgcgaatcgctagtgaccgccgatgtgtcggct
agcgtacggctctacgatataaggaaagcgtactcctccgtacagaactggagcgccggg
acggacgtgtcggcgatggcgatacacacgagcgccgacattctcgcctgtgcaaccagc
cagatcgtcatctacgggctggacggtgtggtgcttagctcgggccgcagcaacgaagga
ttcatggcaccccggaagggtgtggcctcctgtctgtcgtttcataaatacaaactcaat
ctggcggccggctacaacgacaataccgcggcggtgctagtgccatag

DBGET integrated database retrieval system