KEGG   Anopheles gambiae (mosquito): AgaP_AGAP010080Help
Entry
AgaP_AGAP010080   CDS       T01036                                 

Definition
AGAP010080-PA
Orthology
K11854  
ubiquitin carboxyl-terminal hydrolase 35/38 [EC:3.1.2.15]
Organism
aga  Anopheles gambiae (mosquito)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3R
AA seq 314 aa AA seqDB search
GLVNLGNTCYMNSVVQALAMTKQFCTEVLLKQIDAPPFSEIQQLLALLIHSRRPELTPRA
VLASTRPPGFAPGYQQDSSEFLSYLLDRLHEQEKKILNGNVTQQHNTSALISSNGSGTIA
TNSTKTLVQKTFEGQLSVGCLCTVCNSTNHTTETFRSLDLSFPEDSDLSAAGDGTHSVQK
LLDYFCSSEKLVGENQYFCDRCRQLRDCERSVTVAVPPQNLILTIKHFRYDQSRNLRAKL
MNKILHNEDISLTITDEAGHCRQLHYRNYAVVVHYGTSMDSGHYYTYAQDGTGTWFKFND
NYVTECTTSELQNI
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
ggattggttaatttgggtaatacttgctacatgaacagcgtagtgcaagctttggcgatg
accaaacaattttgcacggaagttttgctgaagcaaatcgacgcaccgccattctccgaa
attcaacagctgctggctcttttgattcattcgcgacggcctgaattgaccccgcgtgcg
gtactcgcctcgactaggccacccggtttcgcgccaggctatcagcaggattcctccgag
tttctaagctatttgttagatcgattgcatgagcaggagaaaaagattttaaatggcaat
gttactcagcagcataacacttcggcgctgatttcatcgaacggcagcggaacaatcgcc
accaacagcaccaaaacgctggtgcagaaaaccttcgaaggacagctgtccgttggctgt
ttgtgtacggtttgcaacagcacgaaccacactaccgagacgttccgttcgctcgatttg
tcctttccggaggatagtgatctctcggccgccggcgatggtacgcattctgtacagaaa
ctgctcgactatttctgctcttccgagaagctggtgggcgagaaccagtacttttgtgat
cgctgccggcagctgcgcgattgcgaacgttccgtgaccgttgccgtaccgcctcaaaac
cttattctaacgatcaagcacttccggtacgaccagagccgcaacttgcgggcgaagctg
atgaacaagattctgcacaacgaggacatttcgcttaccatcacggatgaggcaggccac
tgtcgccagctgcactaccgcaactacgcggttgtagtgcactacggtacaagcatggac
tcgggccactattacacttacgcacaggatggtacgggaacgtggttcaagtttaacgat
aactatgtaacggaatgcaccaccagcgagctgcaaaacata

DBGET integrated database retrieval system