KEGG   Anopheles gambiae (mosquito): AgaP_AGAP010217Help
Entry
AgaP_AGAP010217   CDS       T01036                                 

Definition
AGAP010217-PA
Orthology
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
aga  Anopheles gambiae (mosquito)
Brite
Enzymes [BR:aga01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     AgaP_AGAP010217
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3R
AA seq 636 aa AA seqDB search
KAHQIIAIFFRLPALGIASAYAKTQKSPVIDNITDMKELKKLFRTKTNVLILFVAGMKDN
NALLASFRDAAHAVKGQGTMVLLDCNNSEVKKICKKLKATPAPFALKHFKDGDFHKDYDR
QLTTTSMVNFMRDPTGDLPWEEDPIGADVVHVPDAVTLGKFLKKEVKPTLVMFYAPWCGF
CKTLKPEFSAAATELKGRYVLAAIDVNRPENSIIRKQYNITGFPTLLYYENGRMKYTFEG
ENNKAGIVAFMKNPAAPPPTKPKEADWASESSSEIVHLTAGSFEPALKDEKSVLVMFYAP
WCGHCKKMKPEYEKAAEIMKAKNIPGVLAALDATKEASVGQQYGVKGYPTVKYFSNGEFK
FDVNVREADKIVKFMENPTEPPPPPAPETPWEDEPSEVVHLNEETFKPFLKKKKHVLVMF
YAPWCGHCKRAKPEFARAAEHFKEDPKTELAAVDCTRHSAVCSSYEVRGYPTIKYFSYLK
TVRDYNGGRTETDFIAYLKDPSATPLKTDKVAEPFGDFPGSDKILILTDANFEEVSKREP
NLLVMFYAPWCGHCKHMKPDFAKVAQLLTTEKVSAKVAALDCTVHMKTAEKFQIRGYPTL
KLFANGQFRRNYEGKRTAQDMLQFLRTDGAVAKDEL
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
aaagctcatcaaattattgctatctttttcagattgccagctcttggcattgcttcagcc
tacgcgaaaacgcaaaaaagtcccgttatcgacaatataacggacatgaaagaactgaag
aaactgtttcgcacaaaaacaaatgttctgatactgttcgtggcaggaatgaaggacaac
aatgcactgctggcgtccttcagagatgcagcgcatgctgtaaaaggccagggcacgatg
gtgctgctcgattgcaacaattctgaggtgaagaaaatttgcaaaaagctcaaggccaca
ccagcaccctttgcgctgaagcatttcaaagacggcgacttccataaggattacgatcgg
cagctaacgacaactagcatggttaattttatgcgcgatccaaccggagatctgccttgg
gaagaggatccgatcggtgccgatgtggtgcacgttcccgatgccgtgactttgggtaaa
tttttgaaaaaagaagtgaagccaacactggtgatgttttacgctccgtggtgtggtttc
tgtaagacgctcaagcccgagttttctgctgctgcaacggaactgaaaggacgatatgtg
ctggcagcaattgacgtaaatcgacccgaaaactcgatcattcgcaagcagtacaacatt
accgggtttccaacattactatattacgagaacggtcggatgaagtacactttcgaggga
gaaaataacaaagcaggaattgtggcatttatgaaaaatccggccgccccaccaccgacc
aagccaaaggaagcggattgggcatcagaaagctcgtccgaaattgtacatctgacggcg
ggaagctttgaacctgccttgaaggacgaaaaatcggtactagtaatgttttacgcaccg
tggtgtggtcactgcaaaaagatgaaacctgagtacgaaaaagcggccgaaattatgaaa
gccaaaaacattcccggagttcttgcagcgctcgatgcaacaaaggaagcatccgtaggc
cagcagtatggcgtgaaaggctatccgacggtcaagtattttagcaatggtgaatttaaa
ttcgatgtgaatgttcgggaggcggataagatcgtaaagtttatggagaatccaacagag
ccgccacctcctcccgcaccagaaacgccatgggaagacgaaccgtcggaggtggtacat
ttgaatgaggaaacgtttaaaccattcctgaagaaaaagaagcacgtactagtgatgttt
tatgcgccatggtgcgggcattgtaagcgagcgaagccagaattcgcacgagcggccgaa
catttcaaagaggatccaaaaacggagctggcagcggtcgactgtacccggcacagtgcc
gtttgttcgtcttacgaagtccgcggatatcctacaattaagtatttcagctacctaaaa
accgtacgcgactacaatggtggccggacggagactgattttattgcctacttgaaggat
cccagcgcaacacccctgaagactgacaaagtagccgagccgtttggagattttcccggt
tctgataagatacttattttaactgacgccaacttcgaagaggtgtccaaacgggaaccg
aatctgctagttatgttctacgctccgtggtgtggccattgcaagcacatgaagcctgac
tttgccaaggtagctcagcttttgacaaccgagaaagtctcggccaaggtggctgccctc
gattgcacggtgcatatgaaaacggccgaaaagttccaaatacggggctatccgacgctt
aagctcttcgccaacgggcaattccggcgaaactacgaaggcaagcgcactgcgcaagat
atgcttcagttcctgcggactgatggcgcagtggccaaggatgagctgtaa

DBGET integrated database retrieval system