KEGG   Anopheles gambiae (mosquito): AgaP_AGAP010276Help
Entry
AgaP_AGAP010276   CDS       T01036                                 

Definition
AGAP010276-PA
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
aga  Anopheles gambiae (mosquito)
Brite
Enzymes [BR:aga01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     AgaP_AGAP010276
Protein kinases [BR:aga01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   AgaP_AGAP010276
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
VectorBase: 
UniProt: 
Position
3R
AA seq 207 aa AA seqDB search
MKLFPVRLSNINKMLDFYSQFNPSPLSIKQFIDFGLNACPRKSFVFLRKELPVRLANIMK
EITLLPESLLRMPSVGLVSAWYVKSFEEVLAFEKTDPTENNLEKFCKSLTQIRDRHSDVV
QTMAQGILELKESRDGAIEPSTELSIQYFLDRLYMSRISIRMLINQHTILFGDIPQTGRH
IGSIDPLCDPHMVVRDAYENARFLCDQ
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgtttcccgtgcggctgtccaacatcaataagatgttggatttttactcccaa
tttaatccatcacccctgagcattaagcaatttatcgacttcgggcttaatgcatgtcct
cgaaagtcgtttgttttccttcgcaaagagctgcccgtacggttggcgaatataatgaaa
gagatcaccttgctgccagaaagtttattacgaatgccttcagtcggtctggtcagcgcc
tggtatgtgaaaagcttcgaggaagtgctggcattcgaaaaaacggatcctaccgaaaac
aatctagagaaattctgcaaatcgctcacccagattcgtgaccgccactccgatgttgtg
caaacaatggctcaagggatactggaattgaaggaaagccgagatggagcgattgagcca
tccactgagctctcgattcagtactttctggatcgtttgtacatgtcccgtatcagtata
agaatgctcatcaatcagcacactatactgtttggtgatataccgcagacaggacgccat
atcggtagcatagatcctctatgtgatccgcacatggtcgtacgggatgcttacgaaaat
gcacgttttctatgtgatcaa

DBGET integrated database retrieval system